Recombinant Alcanivorax borkumensis Undecaprenyl-diphosphatase(uppP)

Product Type Recombinant Protein
Uniprot No. Q0VQH0
Abbreviation uppP
Species Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Gene Names uppP
Protein Names Recommended name: Undecaprenyl-diphosphatase EC= 3.6.1.27 Alternative name(s): Bacitracin resistance protein Undecaprenyl pyrophosphate phosphatase
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UppP family
Database Links

KEGG: abo:ABO_1130

STRING: 393595.ABO_1130

Product Details for Different Expression Systems

Product Name Recombinant Alcanivorax borkumensis Undecaprenyl-diphosphatase(uppP),Yeast
Code CSB-YP604424
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDWFQALVLALIQGLTEFLPISSSAHLILPSQILGWPDQGLAFDVAVHLGTLLAVMMYYR RDLIAMVGGAGLAVQQRRMNDDLKLGLLVALATIPAVVFGFLGDDFIERELRSALVIAIT TLVFGALLWASDAFGKREFSLARLGVAGAIFIGLAQALALIPGTSRSGITITAALALGYR REDAARFSFLLSIPVILGAGLLKTKDLIEQQVVVDWGMMALGVIVSAVTAYLTIVFFIRL LERVGMLPFVVYRLILGVALLFWLA
Expression Region 1-265
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Alcanivorax borkumensis Undecaprenyl-diphosphatase(uppP),E.coli
Code CSB-EP604424
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDWFQALVLALIQGLTEFLPISSSAHLILPSQILGWPDQGLAFDVAVHLGTLLAVMMYYR RDLIAMVGGAGLAVQQRRMNDDLKLGLLVALATIPAVVFGFLGDDFIERELRSALVIAIT TLVFGALLWASDAFGKREFSLARLGVAGAIFIGLAQALALIPGTSRSGITITAALALGYR REDAARFSFLLSIPVILGAGLLKTKDLIEQQVVVDWGMMALGVIVSAVTAYLTIVFFIRL LERVGMLPFVVYRLILGVALLFWLA
Expression Region 1-265
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Alcanivorax borkumensis Undecaprenyl-diphosphatase(uppP),Baculovirus
Code CSB-BP604424
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDWFQALVLALIQGLTEFLPISSSAHLILPSQILGWPDQGLAFDVAVHLGTLLAVMMYYR RDLIAMVGGAGLAVQQRRMNDDLKLGLLVALATIPAVVFGFLGDDFIERELRSALVIAIT TLVFGALLWASDAFGKREFSLARLGVAGAIFIGLAQALALIPGTSRSGITITAALALGYR REDAARFSFLLSIPVILGAGLLKTKDLIEQQVVVDWGMMALGVIVSAVTAYLTIVFFIRL LERVGMLPFVVYRLILGVALLFWLA
Expression Region 1-265
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Alcanivorax borkumensis Undecaprenyl-diphosphatase(uppP),Mammalian cell
Code CSB-MP604424
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MDWFQALVLALIQGLTEFLPISSSAHLILPSQILGWPDQGLAFDVAVHLGTLLAVMMYYR RDLIAMVGGAGLAVQQRRMNDDLKLGLLVALATIPAVVFGFLGDDFIERELRSALVIAIT TLVFGALLWASDAFGKREFSLARLGVAGAIFIGLAQALALIPGTSRSGITITAALALGYR REDAARFSFLLSIPVILGAGLLKTKDLIEQQVVVDWGMMALGVIVSAVTAYLTIVFFIRL LERVGMLPFVVYRLILGVALLFWLA
Expression Region 1-265
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.