Recombinant Alternaria alternata Heat shock 70 kDa protein(HSP70)

Code CSB-YP302100AZV
Product Type Recombinant Protein
Size US$2959
Uniprot No. P78983
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Allergen: Alt a 3
Species Alternaria alternata (Alternaria rot fungus) (Torula alternata)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD
Research Area Signal Transduction
Source Yeast
Gene Names HSP70
Protein Names Recommended name: Heat shock 70 kDa protein Alternative name(s): Allergen= Alt a 3
Expression Region 1-152aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 18.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

HSP70 Antibodies

HSP70 Antibodies for Alternaria alternata (Alternaria rot fungus) (Torula alternata)

HSP70 Proteins

HSP70 Proteins for Alternaria alternata (Alternaria rot fungus) (Torula alternata)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.