Recombinant Bovine Metalloproteinase inhibitor 3(TIMP3)

Product Type Recombinant Protein
Uniprot No. P79121
Species Bos taurus (Bovine)
Gene Names TIMP3
Protein Names Recommended name: Metalloproteinase inhibitor 3 Alternative name(s): Tissue inhibitor of metalloproteinases 3 Short name= TIMP-3
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby s fundus dystrophy.
HGNC 11822
RGD 3865
MGI 98754
Function Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli.
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Protease inhibitor I35 (TIMP) family
Database Links

KEGG: bta:282094

STRING: 9913.ENSBTAP00000027504

UniGene: Bt.10882

Product Details for Different Expression Systems

Product Name Recombinant Bovine Metalloproteinase inhibitor 3(TIMP3),Yeast
Code CSB-YP023562BO
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence CTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTMVYTIKQMKMYRGFTKMPHVQYIH TEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGC NCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDK SIINATDP
Expression Region 24-211
Protein Description Full Length of Mature Protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Metalloproteinase inhibitor 3(TIMP3),E.coli
Code CSB-EP023562BO
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence CTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTMVYTIKQMKMYRGFTKMPHVQYIH TEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGC NCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDK SIINATDP
Expression Region 24-211
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Metalloproteinase inhibitor 3(TIMP3),Baculovirus
Code CSB-BP023562BO
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence CTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTMVYTIKQMKMYRGFTKMPHVQYIH TEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGC NCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDK SIINATDP
Expression Region 24-211
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Bovine Metalloproteinase inhibitor 3(TIMP3),Mammalian cell
Code CSB-MP023562BO
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence CTCSPSHPQDAFCNSDIVIRAKVVGKKLLKEGPFGTMVYTIKQMKMYRGFTKMPHVQYIH TEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGC NCKIKSCYYLPCFVTSKNECLWTDMFSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDK SIINATDP
Expression Region 24-211
Protein Description Full Length of Mature Protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

TIMP3 ELISA Kit

TIMP3 ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.