Recombinant Bovine Metalloproteinase inhibitor 4(TIMP4)

Code CSB-EP023563BO
Product Type Recombinant Protein
Size US$2466
Uniprot No. O97563
Relevance Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Tissue inhibitor of metalloproteinases 4 ;TIMP-4
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP
Research Area Others
Source E.coli
Gene Names TIMP4
Expression Region 30-224aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 26.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor.
Subcellular Location Secreted
Protein Families Protease inhibitor I35 (TIMP) family
Database Links

KEGG: bta:317694

STRING: 9913.ENSBTAP00000026999

UniGene: Bt.91655

Related Products

TIMP4 Antibodies

TIMP4 Antibodies for Bos taurus (Bovine)

TIMP4 Proteins

TIMP4 Proteins for Bos taurus (Bovine)

TIMP4 ELISA Kit

TIMP4 ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.