Name: Recombinant Bovine Pulmonary surfactant-associated protein B (SFTPB),Yeast
Brand: CUSABIO
SKU: CSB-YP021173BO

Product Details

Purity

>85% (SDS-PAGE)

Target Names

SFTPB

Uniprot No.

P15781

Research Area

Others

Alternative Names

SFTPB; SFTP3; Pulmonary surfactant-associated protein B; SP-B; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe)

Species

Bos taurus (Bovine)

Source

Yeast

Expression Region

188-266aa

Target Protein Sequence

FPIPIPYCWLCRTLIKRIQAVIPKGVLAMTVAQVCHVVPLLVGGICQCLVERYSVILLDTLLGRMLPQLVCGLVLRCSS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

10.7kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-B2M-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am interested in the Catalog # CSB-YP021173BO SFTPB Recombinant Protein and has the following questions:
1.Does the buffer contain some detergent to preserve the structure because of its hydrophobicity?
2.Have you tested biological activity?

Very nice to receive your inquiry.
1. Our default buffer is Tris-based buffer, 50% glycerol which does not contain detergent.
If the customer has special requirement for buffer, please kindly consult with us in pre-sales and remark the requirement in your PO.
2. We haven't tested the biological activity of this protein yest. The protein we provide is mature and full-length, and expressed by Eukaryotic expression system, which should have activity in theory.
However, we haven't done validation yet.
We have interest in the customer's proposal. We could offer 10ug free sample but they should pay the shipping cost.

Target Background

Function

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Gene References into Functions

Measurements of the depth of SP-B(CTERM) indicated the peptide center positions ~8A more deeply than the phosphate headgroups, a topology that may allow the peptide to promote functional lipid structures without causing micellization upon compression. PMID: 22252270
results suggest the hydrophobic surfactant protein, SP-B, protects alveolar surfactant phospholiopids from hydrolysis mediated by multiple sPLA(2) in both vesicles (alveolar subphase) and monomolecular films (air-liquid interface) PMID: 22037357
The hydrophobic surfactant proteins SP-B and SP-C induce formation of bicontinuous inverse cubic phases. PMID: 20409474
Reactive oxygen species inactivation of lipid extract surfactant B (SP-B) biophysical activity appears to involve modification of a maximum of three amino acids: Trp9, Met29, and Met65. PMID: 17425286

Subcellular Location

Secreted, extracellular space, surface film.

Database Links

KEGG: bta:507398

STRING: 9913.ENSBTAP00000042549

UniGene: Bt.42696