Recombinant Caulobacter crescentus Probable transcriptional regulatory protein CCNA_03352 (CCNA_03352)

Product Type Recombinant Protein
Uniprot No. B8H462
Species Caulobacter crescentus (strain NA1000 / CB15N)
Gene Names CCNA_03352
Protein Names Recommended name: Probable transcriptional regulatory protein CCNA_03352
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Cytoplasm
Protein Families TACO1 family
Database Links

KEGG: ccs:CCNA_03352

Product Details for Different Expression Systems

Product Name Recombinant Caulobacter crescentus Probable transcriptional regulatory protein CCNA_03352 (CCNA_03352),Yeast
Code CSB-YP490682DQP
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAES LPKDVIERAIKKSQMGDAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRSYFTKMG GNMGATGSVTFNFDRVGQISYPAKAASEDDMMEAAIEAGADDVTSDMDEEGEGHTVYTAF ESLNDVAAALEAKFGAASNTKIAWRPKMQVPVTGDAVATLMKLLDMLDEDDDVQAVYSNE DISDEDLAKLG
Expression Region 1-251
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Caulobacter crescentus Probable transcriptional regulatory protein CCNA_03352 (CCNA_03352),E.coli
Code CSB-EP490682DQP
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAES LPKDVIERAIKKSQMGDAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRSYFTKMG GNMGATGSVTFNFDRVGQISYPAKAASEDDMMEAAIEAGADDVTSDMDEEGEGHTVYTAF ESLNDVAAALEAKFGAASNTKIAWRPKMQVPVTGDAVATLMKLLDMLDEDDDVQAVYSNE DISDEDLAKLG
Expression Region 1-251
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Caulobacter crescentus Probable transcriptional regulatory protein CCNA_03352 (CCNA_03352),Baculovirus
Code CSB-BP490682DQP
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAES LPKDVIERAIKKSQMGDAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRSYFTKMG GNMGATGSVTFNFDRVGQISYPAKAASEDDMMEAAIEAGADDVTSDMDEEGEGHTVYTAF ESLNDVAAALEAKFGAASNTKIAWRPKMQVPVTGDAVATLMKLLDMLDEDDDVQAVYSNE DISDEDLAKLG
Expression Region 1-251
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Caulobacter crescentus Probable transcriptional regulatory protein CCNA_03352 (CCNA_03352),Mammalian cell
Code CSB-MP490682DQP
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAES LPKDVIERAIKKSQMGDAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRSYFTKMG GNMGATGSVTFNFDRVGQISYPAKAASEDDMMEAAIEAGADDVTSDMDEEGEGHTVYTAF ESLNDVAAALEAKFGAASNTKIAWRPKMQVPVTGDAVATLMKLLDMLDEDDDVQAVYSNE DISDEDLAKLG
Expression Region 1-251
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.