Recombinant Chicken Transcription factor 15(TCF15)

Product Type Recombinant Protein
Uniprot No. P79782
Species Gallus gallus (Chicken)
Gene Names TCF15
Protein Names Recommended name: Transcription factor 15 Short name= TCF-15 Alternative name(s): Paraxis Protein bHLH-EC2
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This protein is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding.
Function May function as an early transcriptional regulator, involved in the patterning of the mesoderm and in lineage determination of cell types derived from the mesoderm.
Subcellular Location Nucleus
Database Links

KEGG: gga:395788

UniGene: Gga.22945

Product Details for Different Expression Systems

Product Name Recombinant Chicken Transcription factor 15(TCF15),Yeast
Code CSB-YP023294CH
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAFTMLRPMAARVLYPDIGMLSEDEENRSESDTSDQSYGCCEGAEARRKVPRKTGPMVMV KQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLG EGCEDGQPCFSAIYGAKGDLDGRQPRSICTFCLSNQRKGGGRRDLGGNCLKVRGVTPLRV ARR
Expression Region 1-183
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Transcription factor 15(TCF15),E.coli
Code CSB-EP023294CH
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAFTMLRPMAARVLYPDIGMLSEDEENRSESDTSDQSYGCCEGAEARRKVPRKTGPMVMV KQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLG EGCEDGQPCFSAIYGAKGDLDGRQPRSICTFCLSNQRKGGGRRDLGGNCLKVRGVTPLRV ARR
Expression Region 1-183
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Transcription factor 15(TCF15),Baculovirus
Code CSB-BP023294CH
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAFTMLRPMAARVLYPDIGMLSEDEENRSESDTSDQSYGCCEGAEARRKVPRKTGPMVMV KQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLG EGCEDGQPCFSAIYGAKGDLDGRQPRSICTFCLSNQRKGGGRRDLGGNCLKVRGVTPLRV ARR
Expression Region 1-183
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Transcription factor 15(TCF15),Mammalian cell
Code CSB-MP023294CH
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAFTMLRPMAARVLYPDIGMLSEDEENRSESDTSDQSYGCCEGAEARRKVPRKTGPMVMV KQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVLLLG EGCEDGQPCFSAIYGAKGDLDGRQPRSICTFCLSNQRKGGGRRDLGGNCLKVRGVTPLRV ARR
Expression Region 1-183
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.