Recombinant Chicken Tryptophan 5-hydroxylase 1(TPH1)

Product Type Recombinant Protein
Uniprot No. P70080
Species Gallus gallus (Chicken)
Gene Names TPH1
Protein Names Recommended name: Tryptophan 5-hydroxylase 1 EC= 1.14.16.4 Alternative name(s): Tryptophan 5-monooxygenase 1
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Product Details for Different Expression Systems

Product Name Recombinant Chicken Tryptophan 5-hydroxylase 1(TPH1),Yeast
Code CSB-YP024100CH
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIEDNKENKDHAPERGRTAIIFSLKNEVGGLVKALKLFQEKHVNLVHIESRKSKRRNSEF EIFVDCDSNREQLNEIFQLLKSHVSIVSMNPTEHFNVQEDGDMENIPWYPKKISDLDKCA NRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPEIEFTEEEIKTWGTVYR ELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPR DFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLG ASDEAVQKLATCYFFTVEFGLCKQEGQLRVYGAGLLSSISELKHSLSGSAKVKPFDPKVT CKQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFGVKYNPYTQSVQILKDTKSIAS VVNELRHELDIVSDALSKMGKQLEV
Expression Region 1-445
Protein Description Full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Tryptophan 5-hydroxylase 1(TPH1),E.coli
Code CSB-EP024100CH
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIEDNKENKDHAPERGRTAIIFSLKNEVGGLVKALKLFQEKHVNLVHIESRKSKRRNSEF EIFVDCDSNREQLNEIFQLLKSHVSIVSMNPTEHFNVQEDGDMENIPWYPKKISDLDKCA NRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPEIEFTEEEIKTWGTVYR ELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPR DFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLG ASDEAVQKLATCYFFTVEFGLCKQEGQLRVYGAGLLSSISELKHSLSGSAKVKPFDPKVT CKQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFGVKYNPYTQSVQILKDTKSIAS VVNELRHELDIVSDALSKMGKQLEV
Expression Region 1-445
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Tryptophan 5-hydroxylase 1(TPH1),Baculovirus
Code CSB-BP024100CH
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIEDNKENKDHAPERGRTAIIFSLKNEVGGLVKALKLFQEKHVNLVHIESRKSKRRNSEF EIFVDCDSNREQLNEIFQLLKSHVSIVSMNPTEHFNVQEDGDMENIPWYPKKISDLDKCA NRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPEIEFTEEEIKTWGTVYR ELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPR DFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLG ASDEAVQKLATCYFFTVEFGLCKQEGQLRVYGAGLLSSISELKHSLSGSAKVKPFDPKVT CKQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFGVKYNPYTQSVQILKDTKSIAS VVNELRHELDIVSDALSKMGKQLEV
Expression Region 1-445
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Chicken Tryptophan 5-hydroxylase 1(TPH1),Mammalian cell
Code CSB-MP024100CH
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIEDNKENKDHAPERGRTAIIFSLKNEVGGLVKALKLFQEKHVNLVHIESRKSKRRNSEF EIFVDCDSNREQLNEIFQLLKSHVSIVSMNPTEHFNVQEDGDMENIPWYPKKISDLDKCA NRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPEIEFTEEEIKTWGTVYR ELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPR DFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLG ASDEAVQKLATCYFFTVEFGLCKQEGQLRVYGAGLLSSISELKHSLSGSAKVKPFDPKVT CKQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFGVKYNPYTQSVQILKDTKSIAS VVNELRHELDIVSDALSKMGKQLEV
Expression Region 1-445
Protein Description Full length protein
Storage Buffer Tris-based buffer,50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.