Recombinant Chicken Vascular endothelial growth factor A (VEGFA)

Code CSB-YP025833CH
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025833CH
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025833CH-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025833CH
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025833CH
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
VEGFA
Uniprot No.
Alternative Names
VEGFA; VEGF; Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
Species
Gallus gallus (Chicken)
Expression Region
27-216
Target Protein Sequence
APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin.
Gene References into Functions
  1. BFGF or VEGF gene therapy corrects insufficiency in the intrinsic healing capacity of tendons. PMID: 26865366
  2. VEGF expression in hyperoxia did not differ from normoxia on D16, yet, was actually approximately 75% higher in hyperoxia than in normoxia on day 18 PMID: 26300121
  3. VEGF-A protein was decreased in cadmium treated extraembryonic membranes. PMID: 26367766
  4. The results demonstrate that Vegf signaling could provide important insights into the complex relationship between bone and vasculature during intramembranous bone development. PMID: 26210172
  5. These data suggest that in ovo leptin administration affects angiogenesis and embryo growth in female chicken embryos, probably through STAT3-mediated VEGF/nitric oxide pathways. PMID: 22417645
  6. Homocysteine exposure causes impaired early extra embryonic vascular development, shown by altered composition of the vascular beds as well as reduced expression of VEGF-A and VEGFR-2. PMID: 22085786
  7. Decrease in VEGF expression induces intussusceptive vascular pruning. PMID: 21921259
  8. Short-term hypoxia transiently up-regulated VEGF146 1.5-fold at day 16 (p < 0.05). A similar trend was observed for VEGF122 (p = 0.058) and VEGF190 (p = 0.08), while no differences were present at day 19. PMID: 19864924
  9. VEGF upregulates heme oxygenase-1 protein expression in vivo in chicken embryo chorioallantoic membranes by a mechanism dependent on an increase in cytosolic calcium levels and activation of protein kinase C. PMID: 12788823
  10. VEGF regulates interaction of pericytes and endothelial cells during vasculogenesis and experimental angiogenesis PMID: 15108306
  11. VEGF signals increases progenitor cell proliferation and decreases retinal ganglion cell genesis PMID: 16672338
  12. VEGF genes and proteins are expressed at high or moderately high levels in healing tendon PMID: 19084187

Show More

Hide All

Protein Families
PDGF/VEGF growth factor family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X