Recombinant Clostridium perfringens Maf-like protein CPF_2400(CPF_2400)

Product Type Recombinant Protein
Uniprot No. Q0TNG7
Abbreviation CPF_2400
Species Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Gene Names CPF_2400
Protein Names Recommended name: Maf-like protein CPF_2400
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Cytoplasm
Protein Families Maf family
Database Links

KEGG: cpf:CPF_2400

STRING: 195103.CPF_2400

Product Details for Different Expression Systems

Product Name Recombinant Clostridium perfringens Maf-like protein CPF_2400(CPF_2400),Yeast
Code CSB-YP604290
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKVILASKSPRRVEILEKIVKEFEVVQSNFDENTIDFKGDIEKYVKDLSRNKAIEVSKRL NEPSIVIAADTVVFQNGKVLEKPKNEEDAFSMLSSLSGNTHKVYSGICLINTYDDTVVTD CDCTEVRFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVEGIKGCYYNVMGLPLNKL YKALENYDITIL
Expression Region 1-192
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Clostridium perfringens Maf-like protein CPF_2400(CPF_2400),E.coli
Code CSB-EP604290
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKVILASKSPRRVEILEKIVKEFEVVQSNFDENTIDFKGDIEKYVKDLSRNKAIEVSKRL NEPSIVIAADTVVFQNGKVLEKPKNEEDAFSMLSSLSGNTHKVYSGICLINTYDDTVVTD CDCTEVRFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVEGIKGCYYNVMGLPLNKL YKALENYDITIL
Expression Region 1-192
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Clostridium perfringens Maf-like protein CPF_2400(CPF_2400),Baculovirus
Code CSB-BP604290
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKVILASKSPRRVEILEKIVKEFEVVQSNFDENTIDFKGDIEKYVKDLSRNKAIEVSKRL NEPSIVIAADTVVFQNGKVLEKPKNEEDAFSMLSSLSGNTHKVYSGICLINTYDDTVVTD CDCTEVRFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVEGIKGCYYNVMGLPLNKL YKALENYDITIL
Expression Region 1-192
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Clostridium perfringens Maf-like protein CPF_2400(CPF_2400),Mammalian cell
Code CSB-MP604290
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKVILASKSPRRVEILEKIVKEFEVVQSNFDENTIDFKGDIEKYVKDLSRNKAIEVSKRL NEPSIVIAADTVVFQNGKVLEKPKNEEDAFSMLSSLSGNTHKVYSGICLINTYDDTVVTD CDCTEVRFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVEGIKGCYYNVMGLPLNKL YKALENYDITIL
Expression Region 1-192
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.