Recombinant Clostridium perfringens Phenylalanine--tRNA ligase alpha subunit(pheS)

Product Type Recombinant Protein
Uniprot No. Q0TP72
Abbreviation pheS
Species Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Gene Names pheS
Protein Names Recommended name: Phenylalanine--tRNA ligase alpha subunit EC= 6.1.1.20 Alternative name(s): Phenylalanyl-tRNA synthetase alpha subunit Short name= PheRS
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Cytoplasm
Protein Families Class-II aminoacyl-tRNA synthetase family, Phe-tRNA synthetase alpha subunit type 1 subfamily
Database Links

KEGG: cpf:CPF_2140

STRING: 195103.CPF_2140

Product Details for Different Expression Systems

Product Name Recombinant Clostridium perfringens Phenylalanine--tRNA ligase alpha subunit(pheS),Yeast
Code CSB-YP604297
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQDKLNQIKELALVEIKEAKDSTTIDTIRVKYLGKKGELTTILRGMGSLSKEERPIVGKL ANEVREVLEAELEAVTKAVKEAEKQEKLKNEVIDISMPGKKQTIGKKHPLEQTLDEMKKI FVSMGFAIEDGPEVEKDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQARVME KQQPPIKMISPGKVFRSDAVDATHSPIFYQMEGLVIDKDITFADLKGTLELFAKKMFGDK VKTKFRPHHFPFTEPSAEMDATCFVCNGKGCKVCKGEGWIEILGCGMVHPQVLRNCGIDP EVYSGFAFGFGVDRMVMLKYGIDDIRLLYESDMRFLNQF
Expression Region 1-339
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Clostridium perfringens Phenylalanine--tRNA ligase alpha subunit(pheS),E.coli
Code CSB-EP604297
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQDKLNQIKELALVEIKEAKDSTTIDTIRVKYLGKKGELTTILRGMGSLSKEERPIVGKL ANEVREVLEAELEAVTKAVKEAEKQEKLKNEVIDISMPGKKQTIGKKHPLEQTLDEMKKI FVSMGFAIEDGPEVEKDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQARVME KQQPPIKMISPGKVFRSDAVDATHSPIFYQMEGLVIDKDITFADLKGTLELFAKKMFGDK VKTKFRPHHFPFTEPSAEMDATCFVCNGKGCKVCKGEGWIEILGCGMVHPQVLRNCGIDP EVYSGFAFGFGVDRMVMLKYGIDDIRLLYESDMRFLNQF
Expression Region 1-339
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Clostridium perfringens Phenylalanine--tRNA ligase alpha subunit(pheS),Baculovirus
Code CSB-BP604297
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQDKLNQIKELALVEIKEAKDSTTIDTIRVKYLGKKGELTTILRGMGSLSKEERPIVGKL ANEVREVLEAELEAVTKAVKEAEKQEKLKNEVIDISMPGKKQTIGKKHPLEQTLDEMKKI FVSMGFAIEDGPEVEKDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQARVME KQQPPIKMISPGKVFRSDAVDATHSPIFYQMEGLVIDKDITFADLKGTLELFAKKMFGDK VKTKFRPHHFPFTEPSAEMDATCFVCNGKGCKVCKGEGWIEILGCGMVHPQVLRNCGIDP EVYSGFAFGFGVDRMVMLKYGIDDIRLLYESDMRFLNQF
Expression Region 1-339
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Clostridium perfringens Phenylalanine--tRNA ligase alpha subunit(pheS),Mammalian cell
Code CSB-MP604297
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MQDKLNQIKELALVEIKEAKDSTTIDTIRVKYLGKKGELTTILRGMGSLSKEERPIVGKL ANEVREVLEAELEAVTKAVKEAEKQEKLKNEVIDISMPGKKQTIGKKHPLEQTLDEMKKI FVSMGFAIEDGPEVEKDYYNFEALNIPKNHPARSEQDTFYINDNVVLRTQTSPVQARVME KQQPPIKMISPGKVFRSDAVDATHSPIFYQMEGLVIDKDITFADLKGTLELFAKKMFGDK VKTKFRPHHFPFTEPSAEMDATCFVCNGKGCKVCKGEGWIEILGCGMVHPQVLRNCGIDP EVYSGFAFGFGVDRMVMLKYGIDDIRLLYESDMRFLNQF
Expression Region 1-339
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.