Recombinant Cupriavidus necator Sec-independent protein translocase protein TatB(tatB)

Product Type Recombinant Protein
Uniprot No. Q0K699
Abbreviation tatB
Species Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Gene Names tatB
Protein Names Recommended name: Sec-independent protein translocase protein TatB
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Together with TatC, TatB is part of a receptor directly interacting with Tat signal peptides. TatB may form an oligomeric binding site that transiently accommodates folded Tat precursor proteins before their translocation.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families TatB family
Database Links

KEGG: reh:H16_A3404

STRING: 381666.H16_A3404

Product Details for Different Expression Systems

Product Name Recombinant Cupriavidus necator Sec-independent protein translocase protein TatB(tatB),Yeast
Code CSB-YP603838DZQ
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIDLGISKLALIGAVALIVIGPERLPKVARTVGALVGRAQRYINDVKAEVSREVELEELR KMRTEFEDAARDVERTIHKEVNEQTQALNEALGGAEGTSGGGSADAGGGFVPSWDAAHKA HNGRKSWRVKQGARPLWFKRQHNVRVWVQSGAARVKRHRPVTRPSRSFFE
Expression Region 1-170
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Cupriavidus necator Sec-independent protein translocase protein TatB(tatB),E.coli
Code CSB-EP603838DZQ
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIDLGISKLALIGAVALIVIGPERLPKVARTVGALVGRAQRYINDVKAEVSREVELEELR KMRTEFEDAARDVERTIHKEVNEQTQALNEALGGAEGTSGGGSADAGGGFVPSWDAAHKA HNGRKSWRVKQGARPLWFKRQHNVRVWVQSGAARVKRHRPVTRPSRSFFE
Expression Region 1-170
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Cupriavidus necator Sec-independent protein translocase protein TatB(tatB),Baculovirus
Code CSB-BP603838DZQ
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIDLGISKLALIGAVALIVIGPERLPKVARTVGALVGRAQRYINDVKAEVSREVELEELR KMRTEFEDAARDVERTIHKEVNEQTQALNEALGGAEGTSGGGSADAGGGFVPSWDAAHKA HNGRKSWRVKQGARPLWFKRQHNVRVWVQSGAARVKRHRPVTRPSRSFFE
Expression Region 1-170
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Cupriavidus necator Sec-independent protein translocase protein TatB(tatB),Mammalian cell
Code CSB-MP603838DZQ
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MIDLGISKLALIGAVALIVIGPERLPKVARTVGALVGRAQRYINDVKAEVSREVELEELR KMRTEFEDAARDVERTIHKEVNEQTQALNEALGGAEGTSGGGSADAGGGFVPSWDAAHKA HNGRKSWRVKQGARPLWFKRQHNVRVWVQSGAARVKRHRPVTRPSRSFFE
Expression Region 1-170
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.