Recombinant Entamoeba histolytica Multidrug resistance protein 1(MDR1)

Code CSB-YP001046EKM
Product Type Recombinant Protein
Size US$2959
Uniprot No. P16875
Relevance Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias P-glycoprotein
Species Entamoeba histolytica
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
Research Area Others
Source Yeast
Gene Names MDR1
Protein Names Recommended name: Multidrug resistance protein 1 Alternative name(s): P-glycoprotein
Expression Region 1-114aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily

Related Products

MDR1 Antibodies

MDR1 Antibodies for Entamoeba histolytica

MDR1 Proteins

MDR1 Proteins for Entamoeba histolytica

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.