Name: Recombinant Escherichia coli Cytolethal distending toxin subunit B (cdtB)
Brand: CUSABIO
SKU: CSB-EP671598ENL

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

cdtB

Uniprot No.

Q46669

Research Area

others

Alternative Names

cdtBCytolethal distending toxin subunit B; CDT B; Deoxyribonuclease CdtB; EC 3.1.-.-

Species

Escherichia coli

Source

E.coli

Expression Region

19-269aa

Target Protein Sequence

DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

47.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Regarding the cytolethal distending toxin (CDT) recombinant protein A,B,C.
(https://www.cusabio.com/Recombinant-Protein/Recombinant-Escherichia-coli-Cytolethal-distending-toxin-subunit-BcdtB-12102551.html)
1. May I know if there is any difference in activity between CDT recombinant protein from E.coli vs mammalian cell?
Will the recombinant protein produced from mammalian cells be more active/ genotoxic?
2. Could you give more information on the measurement of activity of CDT?
3. Does any publication use the CDT recombinant protein from Cusabio before?
4. Is there endotoxin test conducted on these CDT recombinant protein? Are they low in endotoxin?
5. May I know what other recombinant protein that i can use as a negative control?

Thanks for your inquiry.
1. This protein is Bacteroides fragilis, protein from E.coli expression system maybe more suitable.
2. Regarding activity, we didn't test activity of this protein, cannot 100% guaranteed. But what we provide is the full length of mature protein, which is purified under mild condition, it is active in theory.
3. Currently, there is no publication of this product.
4. We could provide endotoxin removal service, and the protein will be low in endotoxin.
5. Could you please tell what experiment you will use this protein for? What kind of negtive control you need?

I want to clarify some details:
· Are the samples all derived from E. coli?
· Are the proteins supplied in powder form?

Thanks for your inquiry. Our response is as below. · Are the samples all derived from E. coli?
Yes, they are.

· Are the proteins supplied in powder form?
The protein will be supplied in liquid form.
The protein concentration is 1.5mg/ml. The storage buffer is 20 mM Tris-HCl, 0.5M NaCl, pH 8.0，50% glycerin.

Target Background

Function

Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement.

Subcellular Location

Secreted. Note=Localized to the nucleus of the infected cells.

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address