Recombinant Human 60S ribosomal protein L36a-like(RPL36AL)

Code CSB-RP018044h
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q969Q0
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names RPL36AL
Expression Region 1-106aa
Tag Info N-terminal GST-tagged
Mol. Weight 39.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cytoplasm
Protein Families Eukaryotic ribosomal protein eL42 family
Tissue Specificity Ubiquitously expressed.
Database Links

HGNC: 10346

OMIM: 180469

KEGG: hsa:6166

UniGene: Hs.444749

Related Products

RPL36AL Antibodies

RPL36AL Antibodies for Homo sapiens (Human)

RPL36AL Antibodies for Human

RPL36AL Proteins

RPL36AL Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.