Recombinant Human Apoptosis regulatory protein Siva(SIVA1)

Code CSB-EP021347HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O15304
Relevance Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD27-binding protein ;CD27BP
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Research Area Cell Biology
Source E.coli
Gene Names SIVA1
Expression Region 1-110aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 27.8kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Induces CD27-mediated apoptosis. Inhibits BCL2L1 isoform Bcl-x(L) anti-apoptotic activity. Inhibits activation of NF-kappa-B and promotes T-cell receptor-mediated apoptosis.
Subcellular Location Cytoplasm, Nucleus
Tissue Specificity Ubiquitous. Mostly expressed in thymus, testis, ovary, prostate, small intestine and spleen and less in colon.
Database Links

HGNC: 17712

OMIM: 605567

KEGG: hsa:10572

STRING: 9606.ENSP00000329213

UniGene: Hs.112058

Related Products

SIVA1 Antibodies

SIVA1 Antibodies for Homo sapiens (Human)

SIVA1 Antibodies for Human

SIVA1 Proteins

SIVA1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.