Recombinant Human Beta-defensin 4A(DEFB4A)

Code CSB-EP006705HU(A4)
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names DEFB4A
Uniprot No. O15263
Alternative Names BD 2; BD-2; BD2; beta 2; beta 2 Defensin; Beta defensin 2; Beta defensin 4B; Beta-defensin 2; Beta-defensin 4A; DEF B2; DEF B4; DEFB 102; DEFB 2; DEFB 4; DEFB102; DEFB2; DEFB2; formerly; DEFB4; DEFB4; formerly; DEFB4B; DEFB4P; Defensin; Defensin beta 2; Defensin; beta 4; Defensin; beta 4; pseudogene; Defensin; beta 4A; Defensin; beta 4B; Defensin; beta; 2; formerly; Defensin; beta; 4; formerly; DFB4A_HUMAN; HBD 2; hBD-2; HBD2; mBD-2; SAP 1; SAP1; Skin antimicrobial peptide 1; Skin-antimicrobial peptide 1
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-64aa
Target Protein Sequence MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 31.3kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells
Gene References into Functions
  1. The encoded peptide has antimicrobial activity against E.coli, S. aureus, and P. aeruginosa. PMID: 9727055
Subcellular Location Secreted
Protein Families Beta-defensin family, LAP/TAP subfamily
Tissue Specificity Expressed in the skin and respiratory tract.
Database Links

HGNC: 2767

OMIM: 602215

KEGG: hsa:100289462

STRING: 9606.ENSP00000424598

UniGene: Hs.105924

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1