Recombinant Human Beta-defensin 4A(DEFB4A)

Code CSB-EP006705HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O15263
Relevance Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Beta-defensin 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
Source E.coli
Gene Names DEFB4A
Protein Names Recommended name: Beta-defensin 4AAlternative name(s): Beta-defensin 2 Short name= BD-2 Short name= hBD-2 Defensin, beta 2 Skin-antimicrobial peptide 1 Short name= SAP1
Expression Region 1-64aa
Tag Info N-terminal GST-tagged
Mol. Weight 31.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells
Subcellular Location Secreted
Protein Families Beta-defensin family, LAP/TAP subfamily
Tissue Specificity Expressed in the skin and respiratory tract.
Database Links

HGNC: 2767

OMIM: 602215

KEGG: hsa:100289462

STRING: 9606.ENSP00000424598

UniGene: Hs.105924

Related Products

DEFB4A Antibodies

DEFB4A Antibodies for Human

DEFB4A Proteins

DEFB4A Proteins for Homo sapiens (Human)

DEFB4A ELISA Kit

DEFB4A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.