Recombinant Human C-C motif chemokine 8(CCL8)

Code CSB-EP004802HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CCL8
Uniprot No. P80075
Research Area Immunology
Alternative Names HC14;Monocyte chemoattractant protein 2;Monocyte chemotactic protein 2 ;MCP-2;Small-inducible cytokine A8
Species Homo sapiens (Human)
Source E.coli
Expression Region 24-99aa
Target Protein Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 35.9kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

Do you happen to have LAL testing done on your CCL8 protein, expressed in Yeast, catalog number CSB-EP004802HU ? We are interested in using this on cells, but we are worried about endotoxin levels. If not, is that something that your company is easily able to run and find out?

A:
Very nice to receive your inquiry. If you would perform cell relevant experiment, we could provide Endotoxin Removal Service and Aseptic Manufacture Processing free of charge. The details are as below.
Please kindly remark "Endotoxin Removal Service & Aseptic Manufacture Processing" in your PO.
Endotoxin Removal Service
a.If customer plans to use a protein in cell culture, please check with us if it has been endotoxin tested and if it is suitable for this purpose.
b.If customer has requirement for endotoxin level, please remark this information when placing the order and we could offer endotoxin removal service free of charge.
c.We use conjugated PMB affinity filler adsorption to remove endotoxin and guarantee endotoxin level within 0.1ng / ug (1EU / ug).
d.Generally, the delivery time will be extended for 2-3 working days.
e.Endotoxin removal result will be shown in COA as follows “<1.0 EU per 1μg of the protein by the LAL method.”
Aseptic Manufacture Processing
a.If customer plans to use a protein in cell culture, please check with them if aseptic manufacture processing is required. If customer has demand for aseptic manufacture processing, then please remark this
information when placing the order.
b.We could offer aseptic manufacture processing service free of charge.
c.The delivery time won’t be extended.
d.We've performed Aseptic processing for liquid protein, before lyophilization, but there may exist contamination during lyophilization process, so we can't say bacteria free for the whole process.
e.Aseptic manufacture processing will be shown in both of datasheet & COA as follows “0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol”.
 Customer Reviews

Target Data

Function Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Subcellular Location Secreted
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.
Database Links

HGNC: 10635

OMIM: 602283

KEGG: hsa:6355

STRING: 9606.ENSP00000378118

UniGene: Hs.271387

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.