Recombinant Human C-C motif chemokine 8(CCL8)

Code CSB-EP004802HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P80075
Relevance Chotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chotactic activity, but inhibits the chotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias HC14;Monocyte chemoattractant protein 2;Monocyte chemotactic protein 2 ;MCP-2;Small-inducible cytokine A8
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Research Area Immunology
Source E.coli
Gene Names CCL8
Expression Region 24-99aa
Tag Info N-terminal GST-tagged
Mol. Weight 35.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Subcellular Location Secreted
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.
Database Links

HGNC: 10635

OMIM: 602283

KEGG: hsa:6355

STRING: 9606.ENSP00000378118

UniGene: Hs.271387

Pathway Chemokine signaling pathway

Q&A and Customer Reviews

Q&A
Q:

Do you happen to have LAL testing done on your CCL8 protein, expressed in Yeast, catalog number CSB-EP004802HU ? We are interested in using this on cells, but we are worried about endotoxin levels. If not, is that something that your company is easily able to run and find out?

A:
Very nice to receive your inquiry. If you would perform cell relevant experiment, we could provide Endotoxin Removal Service and Aseptic Manufacture Processing free of charge. The details are as below.
Please kindly remark "Endotoxin Removal Service & Aseptic Manufacture Processing" in your PO.
Endotoxin Removal Service
a.If customer plans to use a protein in cell culture, please check with us if it has been endotoxin tested and if it is suitable for this purpose.
b.If customer has requirement for endotoxin level, please remark this information when placing the order and we could offer endotoxin removal service free of charge.
c.We use conjugated PMB affinity filler adsorption to remove endotoxin and guarantee endotoxin level within 0.1ng / ug (1EU / ug).
d.Generally, the delivery time will be extended for 2-3 working days.
e.Endotoxin removal result will be shown in COA as follows “<1.0 EU per 1μg of the protein by the LAL method.”
Aseptic Manufacture Processing
a.If customer plans to use a protein in cell culture, please check with them if aseptic manufacture processing is required. If customer has demand for aseptic manufacture processing, then please remark this
information when placing the order.
b.We could offer aseptic manufacture processing service free of charge.
c.The delivery time won’t be extended.
d.We've performed Aseptic processing for liquid protein, before lyophilization, but there may exist contamination during lyophilization process, so we can't say bacteria free for the whole process.
e.Aseptic manufacture processing will be shown in both of datasheet & COA as follows “0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol”.
Customer Reviews

Related Products

CCL8 Antibodies

CCL8 Antibodies for Homo sapiens (Human)

CCL8 Antibodies for Human

CCL8 Proteins

CCL8 Proteins for Homo sapiens (Human)

CCL8 ELISA Kit

CCL8 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.