Recombinant Human Calcium-dependent phospholipase A2(PLA2G5)

Code CSB-YP018103HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P39877
Relevance PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Research Area Cardiovascular
Source Yeast
Gene Names PLA2G5
Protein Names Recommended name: Calcium-dependent phospholipase A2 EC= 3.1.1.4 Alternative name(s): Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5
Expression Region 21-138aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
Involvement in disease Fleck retina, familial benign (FRFB)
Subcellular Location Secreted
Protein Families Phospholipase A2 family
Tissue Specificity Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level).
Database Links

HGNC: 9038

OMIM: 228980

KEGG: hsa:5322

STRING: 9606.ENSP00000364249

UniGene: Hs.319438

Pathway Vascular smooth muscle contraction
Ras signaling pathway

Related Products

PLA2G5 Proteins

PLA2G5 Proteins for Homo sapiens (Human)

PLA2G5 ELISA Kit

PLA2G5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.