Recombinant Human Casein kinase II subunit beta (CSNK2B), partial

Code CSB-RP016554h
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CSNK2B
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Casein kinase 2 beta polypeptide; Casein kinase II beta subunit; Casein kinase II subunit beta; CK II beta; CK2B; CK2N; CSK2B; CSK2B_HUMAN; CSNK 2B; csnk2b; G5A; MGC138222; MGC138224; Phosvitin; Protein G5a
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-215aa
Target Protein Sequence
SSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
51.8kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulatory subunit of casein kinase II/CK2. As part of the kinase complex regulates the basal catalytic activity of the alpha subunit a constitutively active serine/threonine-protein kinase that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Participates in Wnt signaling.
Gene References into Functions
  1. Patients described are the first cases presenting a loss-of-function variant in the CSNK2B gene in the context of intellectual disability (ID), suggesting that CSNK2Bvariants can cause ID. PMID: 28585349
  2. ALMS1, GLT8D1, and CSNK2B are schizophrenia risk genes. PMID: 29483533
  3. We report interactions between CSNK-2beta and IGFBP-1 as well as mTOR and CSNK-2beta, providing strong evidence of a mechanistic link between mTOR and IGF-I signaling, two critical regulators of cell growth via CSNK-2. PMID: 29037858
  4. Casein kinase 2 role in the proliferation of human osteosarcoma cells. PMID: 27959425
  5. Data suggest that cryptochromes (Cry1 and Cry2) mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). PMID: 26562092
  6. AMPKalpha signalling suppresses EMT and secretion of chemokines in renal tubular epithelia through interaction with CK2beta to attenuate renal injury. PMID: 26108355
  7. ARKL1 binds CK2beta through the KSSR motif and this involves a polyserine sequence resembling the CK2beta binding sequence in EBNA1. PMID: 24216761
  8. The high expression of protein kinase CK2beta is closely related to the carcinogenesis and malignancy of esophageal cancer. PMID: 23076192
  9. The high expression of ck2beta in colorectal cancer is closely correlated to carcinogenesis and metastasis. PMID: 21515457
  10. A dysregulation of CK2beta expression might contribute to epithelial-to-mesenchymal-transition induction during cancer progression. PMID: 21755461
  11. C-terminal domain of PLD2 can regulate CKII by accelerating CKIIbeta degradation in HCT116 cells PMID: 21944249
  12. Our findings argue against the hypothesis that genetic variability in the G-Protein-Coupled Receptor Kinase 5 and Casein Kinase 2 genes modifies Parkinson disease susceptibility PMID: 21514207
  13. CK2 enhances the protein level and activity of TTP via the modulation of the MKP-1-p38 MAPK signaling pathway; TGF-beta1 enhances the activity of CK2 PMID: 21507959
  14. Identification of key residues on CK2alpha and CK2beta that play a cooperative role in CK2alpha/CK2beta binding and thermodynamics is important to further understand how these subunits interact in order to form a tetramer. PMID: 21142136
  15. Threonine at amino acid (aa) 770 and serine at aa 854 to 855 of RIG-I are phosphorylated by casein kinase II (CK2) in the resting state of the cell and dephosphorylated when cells are infected by RNA virus. PMID: 21068236
  16. analysis of interaction sites between Wee1 kinase and the regulatory beta-subunit of protein kinase CK2 PMID: 20372791
  17. Freshly isolated peripheral blood mononuclear cells from patients with chronic lymphocytic leukemia (n = 44) showed significantly higher levels of phosphorylated Akt1,PTEN, and casein kinase 2 than healthy persons (n = 8). PMID: 20576813
  18. CK2 could phosphorylate TNFAIP1 in vitro and in vivo, which facilitated the distribution of TNFAIP1 in nucleus and enhanced its interaction with PCNA. PMID: 19851886
  19. The Casein Kinase 2 (CK2) was identified as a binding and regulatory partner for Mitogen- and stress-activated protein kinase(MSK1). PMID: 20044958
  20. Mapping of the interaction domain of the protein kinase CKII beta subunit with target proteins. PMID: 11710515
  21. Protein kinase CK2 dependent phosphorylation of the E2 ubiquitin conjugating enzyme UBC3B induces its interaction with beta-TRCp and enhances beta-catenin degradation. PMID: 12037680
  22. sequencing of full-length DNA encoding subunits in platelets and megakaryocytic cells PMID: 12102635
  23. FGF-1 binds to both the catalytic alpha-subunit & to the regulatory beta-subunit of CK2.The presence of FGF-1 or FGF-2 was found to enhance the autophosphorylation of CK2 beta. PMID: 12145206
  24. results show that the Ring-H2 finger motif of CKBBP1 is necessary for efficient binding to CKIIbeta, as well as for optimal cell proliferation PMID: 12470599
  25. microtubule-associated protein that confers microtubule stability in a phosphorylation-independent manner PMID: 14634006
  26. Casein kinase II (CKII) phosphorylates synphilin-1; beta subunit of this enzyme complex binds to synphilin-1. CKII-mediated phosphorylation of synphilin-1, rather than alpha-synuclein, modulates the aggregation into inclusion bodies. PMID: 14645218
  27. CK2 phosphorylation of La can affect production of the translational machinery PMID: 15485924
  28. These findings support the notion that CK2beta can act as a general modulator of remote docking sites in protein kinase--substrate interactions. PMID: 15940255
  29. there is a functional link between S6K1 II and CK2 signaling, which involves the regulation of S6K1 II nuclear export by CK2-mediated phosphorylation of Ser-17 PMID: 16895915
  30. hNopp140 serves as a negative regulator of CK2 and InsP(6) stimulates the activity of CK2 by blocking the interaction between hNopp140 and CK2 PMID: 17038328
  31. a stabilized form of CK2beta can be used to inhibit cell proliferation PMID: 17681943
  32. protein kinase CK2 is involved in cell cycle regulation and indicate the mechanism by which CDC25A turnover might be regulated by Chk1 in the absence of DNA damage. PMID: 17912454
  33. Further studies in transgenic mice and cultured cells suggest that cellular toxicity, including proteasomal dysfunction, increases casein kinase 2 activity, which results in elevated Ser129 alpha-syn phosphorylation. PMID: 18451726
  34. The regulatory beta-subunit of protein kinase CK2 regulates cell-cycle progression. PMID: 18469858
  35. These findings support the view that CK2beta regulates various intracellular processes by modulating the activity of protein kinases that are distinct from CK2. PMID: 18560763
  36. Data show that these CK2-targeted motifs in MDC1 are required to mediate NBS1 association with chromatin-flanking sites of unrepaired DNA double-strand breaks. PMID: 18583988
  37. In epithelial cells, a fraction of CK2 is associated to the plasma membrane and that this localization is controlled by cell-matrix interactions. PMID: 18587631
  38. presents unbound three-dimensional structure of a CK2beta construct that is fully capable of CK2alpha recruitment and quantify its affinity to CK2alpha thermodynamically PMID: 18824508
  39. CK2beta is widely expressed in endometrial carcinoma , and suggest a role in cell proliferation and anchorage-independent cell growth PMID: 19056846
  40. Casein kinase 2 phosphorylates human cytomegalovirus pUL84, and this interaction is required for oriLyt-dependent DNA replication. PMID: 19091862
  41. These studies support CK2beta as an important regulator of ALK-1 signaling and ALK-1-mediated functions in endothelial cells. PMID: 19592636
  42. These experiments indicate that casein kinase II phosphorylation of varicella-zoster virus open reading frame 63 S186 occurs in the nucleus and possibly identify an initial molecular event operative in virus reactivation. PMID: 19759161

Show More

Hide All

Protein Families
Casein kinase 2 subunit beta family
Database Links

HGNC: 2460

OMIM: 115441

KEGG: hsa:1460

STRING: 9606.ENSP00000365025

UniGene: Hs.73527

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*