Recombinant Human Collagen alpha-1(XVIII) chain(COL18A1),partial

In Stock
Code CSB-YP005725HU
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP005725HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP005725HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names COL18A1
Uniprot No. P39060
Research Area Cell Adhesion
Alternative Names Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473
Species Homo sapiens (Human)
Source Yeast
Expression Region 1578-1754aa
Target Protein Sequence QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 21.3kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.
Gene References into Functions
  1. results suggested that common polymorphisms in these two candidate genes were unlikely to play major roles in the genetic susceptibility to HM. Nevertheless, to avoid filtering real myopia genes, the role of COL11A1 and COL18A1 in the pathogenesis of myopia requires more refinement in both animal models and human genetic epidemiological studies PMID: 29781737
  2. Increased serum levels of endostatin were associated with loss of graft function in kidney transplant recipients. PMID: 29528011
  3. endostatin may have a role in subclinical atherosclerosis as shown in a study of a healthy Japanese population PMID: 28428451
  4. a protease capable of producing endostatin from human Col XVIII, is reported PMID: 27921229
  5. Structural and biological functions of COL18A1, such as its requirement in the maintenance of basement membrane integrity and its emerging roles in regulating cell survival, stem or progenitor cell maintenance and differentiation and inflammation have been reported. (Review) PMID: 27746220
  6. Lower endostatin levels or a predominance of VEGF over endostatin are predictors of poor short-term prognosis of intracranial atherosclerotic stenosis. PMID: 28189572
  7. We further show that the SAGA deubiquitinase-activated gene Multiplexin (Mp) is required in glia for proper photoreceptor axon targeting. Mutations in the human ortholog of Mp, COL18A1, have been identified in a family with a SCA7-like progressive visual disorder, suggesting that defects in the expression of this gene in SCA7 patients could play a role in the retinal degeneration that is unique to this ataxia. PMID: 27261002
  8. Two COL18A1 variants co-segregated with familial epilepsy and anterior polymicrogyria in a family. PMID: 28602933
  9. Blood endostatin wasdddddddddddddddddddddddddf significantly higher in chronic hepatitis C patients with liver fibrosis compared to those without fibrosis. PMID: 27930387
  10. The homozygous DN and NN genotypes of COL18A1 D104N were associated with the risk of osteosarcoma. PMID: 26617886
  11. Endostatin is increased in patients with primary sjogren's syndrome patients with interstitial lung disease. PMID: 27214260
  12. Data show that endostatin levels were elevated in patients with systemic sclerosis (SSc) and mixed connective tissue disease (MCTD). PMID: 26315510
  13. promoter methylation significantly increased in nasal polyp tissues PMID: 26275402
  14. Collaterals formation seems to be associated with the activation of pro-inflammatory factors, growth factors and endostatin in chronic heart failure. PMID: 26771970
  15. Genebased analyses revealed associations of the COL18A1 gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis. PMID: 25424718
  16. Study demonstrates that endostatin has novel ATPase activity, which mediates its antiangiogenic and antitumor activities. PMID: 25788476
  17. ADAM8 and endostatin play a role in osteosarcoma progression. PMID: 25481287
  18. High endostatin expression is associated with malignant pleural effusions in lung cancer. PMID: 25339042
  19. In 2 large cohort studies using serum endostatin as a marker for disease severity and mortality in pulmonary arterial hypertension, a variant in the gene encoding ES, Col18a1, was linked independently with reduced mortality. PMID: 25489667
  20. Serum endostatin is raised in older men who have symptoms of intermittent claudication. PMID: 24600079
  21. The ratio of VEGF/endostatin levels was significantly higher in operable non-small cell lung cancer patients than in normal controls. PMID: 24998915
  22. Female type 2 diabetes mellitus patients have higher serum endostatin levels than males and exercise increases levels in both sexes. PMID: 24393402
  23. Our preliminary findings provide new evidence that endostatin/collagen XVIII concentration in the CSF increases substantially in patients with sTBI PMID: 24089677
  24. Higher endostatin levels are associated with increased risk of early onset pre-eclampsia PMID: 23958573
  25. Hepatocellular carcinoma shows significantly elevated serum levels of angiogenic factors VEGF and Ang-2 and of anti-angiogenic factors endostatin and angiostatin. PMID: 23912396
  26. These results suggest genetic variation in COL15A1 and COL18A1 can modify the age of onset of both early and late onset POAG. PMID: 23621901
  27. data suggest that KS is only caused by biallelic mutations in COL18A1 PMID: 23667181
  28. indicative of good tumor blood supply and permeability of vasculature, are associated with high levels of collagen XVIII and VEGF expression PMID: 23605255
  29. High serum endostatin was associated with increased mortality risk in 2 independent community-based cohorts of the elderly. PMID: 24030549
  30. Transcription levels of VEGF and endostatin by RT-PCR may be an adjunct to cytology screening for early detection of cervical carcinomas and may determine the progressive potentiality of individual lesions, especially in high-risk patients. PMID: 24021340
  31. Binding of VEGF-C and endostatin to recombinant VEGFR-3 is competitive. PMID: 22512651
  32. common germline variants in Endostatin and eNOS genes have predictive significance for clinical outcome and survivality in advanced gastric cancer patients treated with first-line chemotherapy. PMID: 23641912
  33. Report pre/postoperative endostatin levels in surgically treated gastrointestinal cancers. PMID: 22819906
  34. a potential role for collagen XXIII in mediating metastasis by facilitating cell-cell and cell-matrix adhesion as well as anchorage-independent cell growth. PMID: 21963851
  35. Endostatin lowers blood pressure via nitric oxide and prevents hypertension associated with VEGF inhibition PMID: 22733742
  36. In osteosarcoma, expression of endostatin was positively correlated with that of CD34, and was greater in poorly differentiated osteosarcoma than in highly differentiated osteosarcoma. Expression of endostatin correlated with osteosarcoma metastasis. PMID: 22009965
  37. The detection of VEGF mRNA and endostatin mRNA appears to be suitable for distinguishing carcinoma cells from reactive mesothelial cells in pleural effusions, they could be useful to diagnose the pleural micrometastasis. PMID: 22431315
  38. Findings indicate that COL18A1 rs7499 may contribute to the risk of Hepatocellular carcinoma (HCC) in Han Chinese. PMID: 22461898
  39. Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors. PMID: 22303445
  40. study demonstrated significantly elevated endostatin levels in serum and urine samples of bladder cancer patients and show that high endostatin serum concentrations significantly correlate with the presence of lymph node metastasis PMID: 21815140
  41. Peripheral blood osteopontin (OPN) and endostatin (END) levels were studied in 35 patients with adrenal cortex tumors and 10 patients with pheochromocytoma before unilateral adrenalectomy, as well as in 10 healthy subjects (controls). PMID: 21968021
  42. Endostatin induces autophagy in endothelial cells by modulating Beclin 1 and beta-catenin levels PMID: 19298526
  43. Cysteine cathepsins S and L modulate anti-angiogenic activities of human endostatin. PMID: 21896479
  44. Endostatin can effectively inhibit rat peritoneum neoangiogenesis and the effect was dose-dependent. PMID: 21457400
  45. The aim of the study was to evaluate and compare the circulating concentrations of OPN, E-selectin and END of severely obese patients with metabolic syndrome before and after vertical banded gastroplasty. PMID: 21486700
  46. Common polymorphisms in four candidate genes (COL11A1, COL18A1, FBN1 and PLOD1) were unlikely to play important roles in the genetic susceptibility to high myopia. PMID: 21527992
  47. Lack of collagen XVIII long isoforms affects kidney podocytes, whereas the short form is needed in the proximal tubular basement membrane PMID: 21193414
  48. Data show that hypertriglyceridemia occurs in Knobloch patients lacking the vascular form of Col18. PMID: 21085708
  49. suggest that collagen XVIII/endostatin preserves the integrity of the extracellular matrix and capillaries in the kidney, protecting against progressive glomerulonephritis PMID: 20616167
  50. Elevated preoperative serum levels of endostatin in patients with clear cell renal cell carcinoma are associated with higher stage and grade. PMID: 19615205
  51. Direct correlations between the initial levels of VEGF and endostatin and an inverse correlation between VEGF and TNF-beta concentrations were detected in patients with benign neuroendocrine tumors. PMID: 20396759
  52. Overexpression of endostatin effectively inhibits the growth of ovarian cancer. PMID: 16008891
  53. The transfected endostatin could inhibit endothelial proliferation and migration. PMID: 19585274
  54. high collagen XVIII expression may serve a useful biomarker for predicting survival time and time to progression in patients with metastatic gastric cancer PMID: 20361288
  55. Endostatin and TG-2 are co-localized in the extracellular matrix secreted by endothelial cells under hypoxia, which stimulates angiogenesis. PMID: 20156196
  56. The mean serum level of endostatin in healthy individuals was significantly lower than in the total group of patients with bone tumors. PMID: 20027339
  57. Polymorphisms in PAR-1, ES, and IL-8 may serve as independent molecular prognostic markers in patients with localized gastric adenocarcinoma PMID: 19622587
  58. Arginine clusters in the heparin binding motif of endostatin significantly contribute to its interaction with receptor nucleolin and mediate the antiangiogenic and antitumor activities of endostatin. PMID: 19877579
  59. Hypoxia down-regulates endostatin production by microvascular endothelial cells and pericytes PMID: 11700031
  60. An increase of about one-third of normal endostatin serum levels may represent an effective therapeutic dose to significantly inhibit many solid tumours. PMID: 11781696
  61. Endostatin causes G1 arrest of endothelial cells through inhibition of cyclin D1. PMID: 11815623
  62. Endostatin plays a crucial role in endothelial tubule stabilization, maintenance and integrity during angiogenesis. PMID: 11911017
  63. type XV and XVIII collagens are expressed in specialized basement membranes. PMID: 11937714
  64. production in head and neck carcinoma modulated by hsp47 PMID: 12174873
  65. Serum levels of angiogenin, basic fibroblast growth factor and endostatin in patients receiving intensive chemotherapy for acute myelogenous leukemia. PMID: 12209593
  66. There is a positive correlation between the levels of tissue endostatin and malignancy grades in gliomas. The endostatin may be released near the tumor blood vessels with hyperplasia to counteract angiogenic stimuli in malignant gliomas. PMID: 12231538
  67. Data are consistent with a model of endostatin with two binding sites: one mainly to laminin in the basement membrane and the other to heparan sulfates on the cell surface. PMID: 12237301
  68. Collagen XVIII is a heparan sulfate proteoglycan associated with vascular amyloid beta and senile plaques in Alzheimer Disease. PMID: 12408231
  69. Molecular analysis of collagen XVIII reveals novel mutations, presence of a third isoform, and possible genetic heterogeneity in Knobloch syndrome PMID: 12415512
  70. Accumulation of endostatin/collagenXVIII in brains of patients who died with cerebral malaria. PMID: 12458056
  71. Aberrant neuronal and paracellular deposition of endostatin in brains of patients with Alzheimer's disease. PMID: 12486154
  72. endostatin competes with fibronectin/RGD cyclic peptide to bind alpha 5 beta 1 integrin PMID: 12682293
  73. A recombinant fusion version of this protein may be a therapeutic agent for breast cancer. PMID: 12839947
  74. level of endostatin was lower in the group of chronic lymphocytic leukemia patients with progressive disease as compared to patients with stable disease PMID: 12857600
  75. Data indicate that serum endostatin levels are higher in multiple myeloma patients than in healthy controls, with the highest values found during the active phase of the disease. PMID: 14514474
  76. analyses of age-matched study groups revealed elevated medians of endostatin concentration for severely and mildly preeclamptic patients PMID: 14519482
  77. Analysis of knobloch syndrome-associated mutations in COL18A1 and genetic variation in endostatin. PMID: 14695535
  78. Plasma endostatin increased after surgical removal of primary tumor. Decreased intratumoral microvessels in patients with higher endostatin levels may be due to apoptosis-inducing effect of endostatin on microvascular endothelial cells. PMID: 14732364
  79. Pleural mesothelial cells play a key role in the antiangiogenesis process by producing endostatin in the pleural space PMID: 14760864
  80. there is a putative integrin-binding sequence with anti-migratory activity within endostatin PMID: 14973128
  81. Lentivirus-mediated gene transfer might represent an effective strategy for expression of angioinhibitory peptides to achieve inhibition of human bladder cancer proliferation and tumor progression. PMID: 15014038
  82. E-selectin is required for the antiangiogenic activity of endostatin in vivo and ex vivo and confers endostatin sensitivity to nonresponsive human endothelial cells in vitro PMID: 15148373
  83. Collagen XVIII and enamelysin were co-localized in the developing enamel matrix and stratum intermedium and in the enamel-like tumor matrix of odontogenic tumors. PMID: 15296943
  84. Expression of collagen XVIII in tumor tissue is strongly associated with a poorer outcome in non-small-cell lung cancer and correlates with elevated levels of circulating serum endostatin. PMID: 15328173
  85. Naked endostatin plasmid intratumoral injection can get a similar gene transfection efficiency to liposome-DNA complex when used in situ in inhibiting cell growth. PMID: 15334690
  86. Hypoxia downregulates the concentration of endostatin in the culture media of human endometrial stromal cells. PMID: 15374730
  87. Spatial and temporal expression of endostatin/collagen XVIII in cartilaginous tissue and its inactivation of VEGF signalling suggests that it is important for development and maintenance of avascular zones in cartilage and fibrocartilage. PMID: 15464359
  88. Endostatin diminishes the levels of nitric oxide (NO) whereas NO donors enhanced VEGF expression and collagen XVIII expression. PMID: 15540202
  89. Increased endostatin/collagen XVIII expression correlated with hepatoma progression and predicted poor prognosis for patients with hepatocellular carcinoma. PMID: 15605080
  90. angiostatic function is heparan sulfate-dependent, and in situ-binding of endostatin to endothelial cells is increased by heparan sulfates PMID: 15694132
  91. Biologically active endostatin, generated by matrix metalloproteases from collagen XVIII, may participate in the inhibition of endothelial cell proliferation, migration and angiogenesis. PMID: 15950618
  92. results demonstrate that there is a direct connection between dependence of endostatin activity on heparin-like glycosaminoglycans and its ability to antagonize bFGF PMID: 15985216
  93. Elevated serum levels of endostatin were observed in patients with idiopathic pulmonary fibrosis PMID: 16025479
  94. Mechanically induced VEGF is involved in the destruction and endostatin in the maintenance of avascular tissues of the bone and joint system. (review) PMID: 16320826
  95. Significantly higher serum concentrations of endostatin are associated with lung carcinoma PMID: 16358965
  96. data show that inhibition of PI3K/protein kinase B (PKB) increased endostatin-induced apoptosis, and that endostatin-induced cell death is physiologically linked to PKB-mediated cell survival through caspase-8 PMID: 16466644
  97. The results indicate that the antiangiogenic functions of endostatin(ES) critically depend on the mode of delivery and the site of expression. PMID: 16793908
  98. Homozygous COL18A1 polymorphism is a determinant of inherited breast cancer risk. PMID: 16807676
  99. An increase of endostatin/collagen XVIII-positive macrophages/microglial cells is observed, but not astrocytes, up to day 14 and a consequent decrease to day 16 in patients with post-traumatic brain injury. PMID: 16866623
  100. Results suggest for the first time that an elevated serum level of endostatin at the diagnosis of metastatic gastric cancer could be predictive of a poor outcome. PMID: 16998835

Show More

Hide All

Involvement in disease Knobloch syndrome 1 (KNO1)
Subcellular Location Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, extracellular matrix, basement membrane, SUBCELLULAR LOCATION: Non-collagenous domain 1: Secreted, extracellular space, extracellular matrix, basement membrane, Secreted, SUBCELLULAR LOCATION: Endostatin: Secreted, Secreted, extracellular space, extracellular matrix, basement membrane
Protein Families Multiplexin collagen family
Tissue Specificity Present in multiple organs with highest levels in liver, lung and kidney.
Database Links

HGNC: 2195

OMIM: 120328

KEGG: hsa:80781

STRING: 9606.ENSP00000347665

UniGene: Hs.517356

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1