Recombinant Human Collagen alpha-1(XVIII) chain(COL18A1),partial

In Stock
Code CSB-YP005725HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P39060
Relevance COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP005725HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP005725HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Research Area Cell Adhesion
Source Yeast
Gene Names COL18A1
Protein Names Recommended name: Collagen alpha-1(XVIII) chainCleaved into the following chain: 1. Endostatin
Expression Region 1578-1754aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 21.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.
Involvement in disease Knobloch syndrome 1 (KNO1)
Subcellular Location Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, extracellular matrix, basement membrane, SUBCELLULAR LOCATION: Non-collagenous domain 1: Secreted, extracellular space, extracellular matrix, basement membrane, Secreted, SUBCELLULAR LOCATION: Endostatin: Secreted, Secreted, extracellular space, extracellular matrix, basement membrane
Protein Families Multiplexin collagen family
Tissue Specificity Present in multiple organs with highest levels in liver, lung and kidney.
Database Links

HGNC: 2195

OMIM: 120328

KEGG: hsa:80781

STRING: 9606.ENSP00000347665

UniGene: Hs.517356

Related Products

COL18A1 Antibodies

COL18A1 Antibodies for Homo sapiens (Human)

COL18A1 Proteins

COL18A1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.