Recombinant Human Collagen alpha-3(VI) chain(COL6A3) ,partial

In Stock
Code CSB-YP005753HU1
Product Type Recombinant Protein
Size
Uniprot No. P12111
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity >85% (SDS-PAGE)
Sequence KPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG
Source Yeast
Gene Names COL6A3
Protein Names Recommended name: Collagen alpha-3(VI) chain
Expression Region 2986-3176aa
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Collagen VI acts as a cell-binding protein.
Involvement in disease Bethlem myopathy 1 (BTHLM1); Ullrich congenital muscular dystrophy 1 (UCMD1); Dystonia 27 (DYT27)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Type VI collagen family
Database Links

HGNC: 2213

OMIM: 120250

KEGG: hsa:1293

STRING: 9606.ENSP00000295550

UniGene: Hs.233240

Pathway PI3K-Akt signaling pathway
Focal adhesion

Related Products

COL6A3 Antibodies

COL6A3 Antibodies for Homo sapiens (Human)

COL6A3 Proteins

COL6A3 Proteins for Homo sapiens (Human)

COL6A3 ELISA Kit

COL6A3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.