Recombinant Human Coronin-1A (CORO1A)

Code CSB-YP005813HU
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005813HU
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP005813HU-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP005813HU
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP005813HU
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CORO1A
Uniprot No.
Alternative Names
Actin binding protein ; CLABP; Clipin A; Clipin-A; CLIPINA; COR1A_HUMAN; CORO1A; Coronin 1; Coronin actin binding protein 1A ; Coronin like protein A; Coronin like protein p57; Coronin-1A; Coronin-like protein A; Coronin-like protein p57; FLJ41407; HCORO1; MGC117380; OTTHUMP00000163017; p57; TACO; Tryptophan aspartate containing coat protein; Tryptophan aspartate-containing coat protein
Species
Homo sapiens (Human)
Expression Region
2-461aa
Target Protein Sequence
SRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes.
Gene References into Functions
  1. Levels of p21 and p27 were decreased in TACO or pAKT overexpressing HCC due to SKP2 upregulation. PMID: 27779207
  2. Data suggest that CORO1A plays key role in neuronal signaling; roles of CORO1A in multiple signaling pathways suggest that CORO1A may influence cross talk between key pathways. [REVIEW] PMID: 28215292
  3. It has been shown that WDR26 promotes Rac1 membrane translocation following a Coro1A-like and Coro1A-dependent mechanism. PMID: 27835684
  4. Our studies demonstrate the importance of intact CORO1A C-terminal domains in thymic egress and T-cell survival, as well as in defense against viral pathogens. PMID: 26476480
  5. These findings suggest that coronin 1A modulates endothelial cell apoptosis by regulating p38beta expression and activation. PMID: 25936522
  6. Together, these findings both in Jurkat T cells as well as in primary T cells indicate a regulatory role of Coro1A on PKCtheta; recruitment and function downstream of the TCR leading to NF-kappaB transactivation. PMID: 25889880
  7. mutatiions result in abnormal T-cells, severe combined immunodeficiency of an epidermodysplasia verruciformis-human papilloma virus mucocutaneous syndrome with B and NK defects and shortened telomeres PMID: 25073507
  8. Coronin 1 trimerization is essential to promote mycobacterial survival within macrophages PMID: 25217836
  9. Nox4-mediated redox regulation of PTP1B serves as a modulator, in part through coronin-1C, of the growth and migration of glioblastoma cells. PMID: 24239742
  10. Absence of coronin 1A is associated with severe combined immunodeficiency in humans, hypomorphic mutations lead to a profound defect in naive T cells, expansion of oligoclonal memory T cells, and susceptibility to Epstein Barr B lymphoproliferation. PMID: 25269405
  11. Results indicate that Coronin1 proteins are at the center of a regulatory hub that coordinates Rac1 activation, effector exchange, and the F-actin organization state during cell signaling. PMID: 24980436
  12. show a critical role for F-actin deconstruction in cytotoxic function and immunological secretion and identify Coro1A as its mediator PMID: 24760828
  13. These results demonstrate that coronin-1a is a novel antibody target for clinically isolated syndrome and multiple sclerosis. PMID: 23745754
  14. Our findings define a new clinical entity of a primary immunodeficiency with increased susceptibility to EBV-induced lymphoproliferation in patients associated with hypomorphic Coronin-1A mutation. PMID: 23522482
  15. PU.1 and CEBPA are direct transcriptional regulators of CORO1A in acute promyelocytic leukemia and acute myeloid leukemia. PMID: 23252456
  16. Constitutive turnover of phosphorylation at Thr-412 of p57/coronin-1 regulates its interaction with actin. PMID: 23100250
  17. Coronin 1A promotes a cytoskeletal-based feedback loop that facilitates Rac1 translocation and activation PMID: 21873980
  18. Instead of regulating the F-actin cytoskeleton, coronin 1 functions in balancing pro- and antiapoptotic signals by regulating divalent calcium ion fluxes and calcineurin activation downstream of the T cell receptor. PMID: 21339362
  19. These results demonstrate that p57/coronin-1 forms homodimers, that the association is mediated by the leucine zipper structure in the C-terminal region, and that it plays a role in the cross-linking of F-actin in the cell. PMID: 15601263
  20. The leukocyte plasma membrane associates with the actin cytoskeleton through coronin-1. PMID: 15800061
  21. downregulation of TACO gene transcription restricts entry/survival of mycobacteria within macrophages PMID: 16040207
  22. Our results strongly suggested that there was a new actin-binding region at the C-terminus of p57. PMID: 16467882
  23. Coronin-1 accumulates at the leading edge of migrating neutrophils and at the nascent phagosome. PMID: 17442961
  24. phosphorylation of p57/coronin-1 down-regulates its association with actin and modulates the reorganization of actin-containing cytoskeleton PMID: 18693254
  25. Findings establish a function for coronin 1A in T cell egress, identify a surface of coronin involved in Arp2/3 regulation. PMID: 18836449
  26. Circulating neutrophils from CF patients had more coronin-1 expression, associated with a lower apoptosis rate PMID: 19454722

Show More

Hide All

Involvement in disease
Immunodeficiency 8 (IMD8)
Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Cytoplasmic vesicle, phagosome membrane.
Protein Families
WD repeat coronin family
Tissue Specificity
Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut.
Database Links

HGNC: 2252

OMIM: 605000

KEGG: hsa:11151

STRING: 9606.ENSP00000219150

UniGene: Hs.415067

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X