Recombinant Human Cystathionine beta-synthase (CBS), partial

In Stock
Code CSB-EP004589HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004589HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CBS.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004589HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CBS.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CBS
Uniprot No.
Research Area
Metabolism
Alternative Names
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-551aa
Target Protein Sequence
PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
64.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 2-551 form the expressed segment for recombinant Human CBS. This CBS protein is theoretically predicted to have a molecular weight of 64.5 kDa. Expression of this CBS protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of CBS, making it easier to detect and purify the CBS recombinant protein in the later stages of expression and purification.

Cystathionine beta-synthase (CBS) is a crucial enzyme primarily involved in the metabolic pathway of homocysteine. One of its most popular and critical research areas focuses on its regulatory role in metabolism and diseases. CBS plays a key role in sulfur amino acid metabolism, participating in the conversion between cysteine and homocysteine, thereby influencing the body's sulfur metabolism balance. Recent studies have shown a widespread interest in the association of CBS with significant diseases, particularly cardiovascular diseases related to hyperhomocysteinemia. Elevated homocysteine levels are closely linked to atherosclerosis and cardiovascular diseases, making CBS a hot topic in research as an essential regulatory factor in this pathway. Additionally, CBS is implicated in various physiological and pathological processes related to the nervous system, tumors, and more. In the nervous system, CBS plays a role in neurotransmitter synthesis and oxidative stress response, garnering attention in the study of diseases associated with the nervous system. In the field of tumors, some studies suggest CBS's involvement in the proliferation and survival mechanisms of tumor cells, providing a new perspective for understanding cancer development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Involvement in disease
Cystathionine beta-synthase deficiency (CBSD)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cysteine synthase/cystathionine beta-synthase family
Tissue Specificity
In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Database Links

HGNC: 1550

OMIM: 236200

KEGG: hsa:102724560

UniGene: Hs.533013

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*