Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
Species
Homo sapiens (Human)
Expression Region
2-551aa
Target Protein Sequence
PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 2-551 form the expressed segment for recombinant Human CBS. This CBS protein is theoretically predicted to have a molecular weight of 64.5 kDa. Expression of this CBS protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of CBS, making it easier to detect and purify the CBS recombinant protein in the later stages of expression and purification.
Cystathionine beta-synthase (CBS) is a crucial enzyme primarily involved in the metabolic pathway of homocysteine. One of its most popular and critical research areas focuses on its regulatory role in metabolism and diseases. CBS plays a key role in sulfur amino acid metabolism, participating in the conversion between cysteine and homocysteine, thereby influencing the body's sulfur metabolism balance. Recent studies have shown a widespread interest in the association of CBS with significant diseases, particularly cardiovascular diseases related to hyperhomocysteinemia. Elevated homocysteine levels are closely linked to atherosclerosis and cardiovascular diseases, making CBS a hot topic in research as an essential regulatory factor in this pathway. Additionally, CBS is implicated in various physiological and pathological processes related to the nervous system, tumors, and more. In the nervous system, CBS plays a role in neurotransmitter synthesis and oxidative stress response, garnering attention in the study of diseases associated with the nervous system. In the field of tumors, some studies suggest CBS's involvement in the proliferation and survival mechanisms of tumor cells, providing a new perspective for understanding cancer development.