Recombinant Human Cystatin-C(CST3)

Unavailable
Code CSB-YP006091HU
Size Pls inquire other sizes
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006091HU
Size Pls inquire other sizes
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006091HU-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP006091HU
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP006091HU
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names CST3
Uniprot No. P01034
Research Area Cardiovascular
Alternative Names AD 8; AD8; Amyloid angiopathy and cerebral hemorrhage; ARMD11; bA218C14.4 (cystatin C); bA218C14.4; Cst 3; Cst3; CST3 protein; Cystatin 3; Cystatin-3; Cystatin-C; Cystatin3; CystatinC; CYTC_HUMAN; Epididymis secretory protein Li 2; Gamma trace; Gamma-trace; HCCAA; HEL S 2; MGC117328; Neuroendocrine basic polypeptide; Post gamma globulin; Post-gamma-globulin
Species Homo sapiens (Human)
Expression Region 2-102aa
Target Protein Sequence SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Mol. Weight 13.4kD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
Gene References into Functions
  1. Urinary cystatin-C levels were increased in type 2 diabetic patients with early diabetic nephropathy. PMID: 29673928
  2. Age and cystatin C were found to be significant risk factors for cardiovascular events in a pre-diabetic cohort. PMID: 29661604
  3. Increased cystatin C levels may be associated with enhanced risks of composite endpoints in patients with ST-elevation acute myocardial infarction undergoing elective percutaneous coronary intervention PMID: 29891036
  4. Data suggest that kinetics of degradation/proteolysis versus of aggregation of amyloid beta(1-40) and amyloid beta(1-42) at specific concentrations of amyloid beta, cathepsin B, and cystatin C can be modeled and predicted. PMID: 29046353
  5. Serum CysC, at the time of CRRT (Continuous Renal Replacement Therapy cessation), is an independent predictor of the successful weaning from CRRT in critically ill patients with acute kidney injury. PMID: 29870981
  6. The serum levels of cystatin C and urine NGAL, urine OPN can be used as a good marker for assessing the renal effect of obesity which can lead end stage renal disease in pediatric population. PMID: 30035656
  7. The average of estimated glomerular filtration rate (eGFRave) based on creatinine (eGFRcre) and eGFR based on cystatin C (eGFRcys) best predicted the exacerbation of renal function in allogeneic hematopoietic cell transplantation (allo-HCT). PMID: 29086660
  8. Studied serum Cystatin C as a biomarker in bladder urothelial neoplasm; results found serum Cystatin C not to be a reliable marker in predicting bladder urothelial tumors tumorigenesis and clinicopathological characteristics. PMID: 29789781
  9. bladder cancer (BCa) patients have lower serum cysC concentration than the control group. Serum cysC may be considered as a potential marker of BCa but not its aggressiveness. PMID: 29749360
  10. Postoperative serum Cystatin C, IL-18 and Uric acid after 24h were significantly associated with acute kidney injury PMID: 29627485
  11. Serum CysC is a strong predictor of AKI and the short-term prognosis of CCU patients. PMID: 29179178
  12. Neutrophil gelatinase-associated lipocalin concentrations in the urine and serum on the second day of intensive care unit admission could be used to predict the development of acute kidney injury in the following three to seven days in the intensive care unit; however, the cystatin C concentration did not have predictive value PMID: 28142264
  13. Study demonstrated that the binding of CST3 and PSAP decreased the inhibitory effects of CST3 on proteinase in vitro. The co-localization of both proteins was detected in cultured cells and in Bunina body-containing motor neurons from patients with amyotrophic lateral sclerosis, suggesting that they might be involved in the process of Bunina body formation. PMID: 29249381
  14. elevated cystatin C is independently associated with adverse vascular outcomes in people with suspected or established CAD in terms of all-cause mortality, cardiovascular mortality, and total adverse vascular events [meta-analysis] PMID: 28599259
  15. Cognitive function was significantly and inversely associated with cystatin C and microalbuminuria, in the relatively younger general Japanese population. PMID: 28865325
  16. This paper discusses the current findings regarding the role of Cyst C in cancer progression and the clinical implications emerging from these studies--{review} PMID: 29654808
  17. We enrolled 43 stable coronary artery disease (CAD) male patients to examine the relationship between cystatin C-adiponectin (CysC-APN) complex and coronary plaque characteristics. In multivariate analysis, CysC-APN complex levels were identified as the strongest negative factor for fibrotic components and the strongest positive factor for both necrotic and lipidic plus necrotic components. PMID: 28321013
  18. Urinary cystatin C is an independent risk predictor in patients with acute myocardial infarction. PMID: 28778467
  19. serum Cys-C levels predict renal function in patients with prostate neoplasia, but were not a biomarker for the development of prostate neoplasia, and were not correlated with the clinicopathological characteristics of prostate cancer . PMID: 28812020
  20. There were no associations between serum cysC levels and renal involvement in patients with primary Sjogren's syndrome. PMID: 25367815
  21. cystatin-C should be considered an early biomarker of AKI PMID: 28552392
  22. CysC is as an early acute kidney injury biomarker and predictive of persistent acute kidney injury on aminoglycoside treatment. PMID: 27743042
  23. Cystatin C may be considered a biological marker for vascular dysfunction and subclinical atherosclerosis in SCD. PMID: 27582023
  24. Serum cystatin C level was significantly associated with subclinical atherosclerosis. An increase in cystatin C level could be a valuable surrogate marker for the risk of cardiovascular disease in patients with type 2 diabetes mellitus. PMID: 29090609
  25. Mild-to-moderate kidney dysfunction modifies the relationship between CysC and high-risk coronary lesion, but not NGAL. PMID: 27680774
  26. Increasing cystatin C and cathepsin B reported in serum of colorectal cancer patients. PMID: 28182342
  27. Both cystatin C and beta 2 macroglobulin are elevated in type 2 diabetics with diabetic nephropathy. Cystatin C may be useful in the early diagnosis of diabetic nephropathy PMID: 28182344
  28. Results from nuclear magnetic resonance structural data and molecular dynamics modeling point to conformational requirements and special importance of some amino acid residues in cystatin 3 C-terminal for the its interaction with amyloid beta fragments. PMID: 27714883
  29. The findings of the current studies may be important for future design of hCC dimerization inhibitors. PMID: 27573935
  30. High cystatin C was associated with increased risk of mortality but not with poor functional outcome in patients with acute intracerebral hemorrhage. PMID: 27578255
  31. this results identified cystatin 3 as a biomarker in patients with seasonal allergic rhinitis PMID: 28633877
  32. Serum and urine levels of cystatin C were significantly higher in children with acute kidney injury. [Review and Meta-Analysis] PMID: 28372557
  33. serum level in acute kidney injury patients helps predict risk of chronic kidney disease stage 3 PMID: 27658322
  34. Circulating CysC and Gal-3 were associated with greater left atrial dilatation in patients with heart failure with reduced left ventricular ejection fraction. PMID: 28830298
  35. Application of the cystatin C-based equations most accurately estimate glomerular filtration rate in Chinese patients with chronic kidney disease. PMID: 27125433
  36. This study tested the utility of neutrophil gelatinase-associated lipocalin (NGAL) and cystatin C (CysC) in addition to standard creatinine for early determination of Acute Kidney Injury (AKI) After Heart Operations Using Cardiopulmonary Bypass. The results support the notion that CysC and NGAL should be viewed as comparable for early AKI detection. PMID: 27862029
  37. The strong association between epicardial adipose tissue (EAT) and cystatin C demonstrated herein indicates that EAT accumulation may play an important role in Cystatin C secretion, possibly contributing to cardiometabolic risk in T2DM patients. PMID: 28922364
  38. A high CysC level had predictive value regarding the severity of vascular lesions in acute coronary syndrome. PMID: 28143410
  39. Elevated levels of cystatin C were detected in early diagnosis of right heart failure in patients with systemic sclerosis. PMID: 27414726
  40. biomarker of renal dysfunction, acute-on-chronic liver failure, and hepatorenal syndrome in decompensated liver cirrhosis PMID: 28545169
  41. Data suggest that melanoma cells internalize/absorb cystatin C from culture media, leading to increased intracellular cystatin C levels; cystatin E/M is internalized as well but at modest rate due to down-regulation of cell migration; however, the effect of intracellular cystatin E/M on down-regulation of legumain activity is pronounced. PMID: 28630039
  42. An elevated preoperative Cys-C level was demonstrated to be related with worse survival in patients with renal cell carcinoma(RCC). Measuring preoperative serum Cys-C might be a simple way for finding poor prognostic patients and patients with elevated preoperative Cys-C level should be more closely followed up PMID: 28586363
  43. Acute kidney injury is common following deliberate self-poisoning with a combination washing powder containing oxalic acid and potassium permanganate and cystatin C monitoring may under estimate the severity of poisoning. PMID: 28535124
  44. Cystatin C significantly decreased the lipopolysaccharide-stimulated release and expression of interleukin-1beta and tumor necrosis factor-alpha in monocyte and peripheral blood mononuclear cultures from healthy donors and Crohn's patients. Cystatin C was internalized by monocytes via an active endocytic process, decreased phosphorylation of the MAP kinase pathway ERK-1/2, and altered surface markers. PMID: 27190304
  45. Fibrillation of CysC therefore likely initiates from the monomer and does not require domain-swapping. The non-swapped oligomers likely represent a dead-end offshoot of the amyloid pathway and must dissociate to monomers prior to rearranging to amyloid fibrils. These prefibrillar CysC oligomers were potent inhibitors of aggregation of the Alzheimer's-related peptide, beta-amyloid. PMID: 28487367
  46. CysC plays an important regulatory role in combating cell death via the autophagic pathway in atherosclerosis. PMID: 27079462
  47. Data show that cystatin C deposition in minimally affected samples was limited to the basement membrane (BM) between the dermis and epidermis. PMID: 28067897
  48. Urinary cystatin C levels in the acute kidney injury (AKI) preterm infant group were not significantly higher than in no-AKI group on day of life 1, 3 and 7. PMID: 27020372
  49. Serum cystatin C level was found to be associated with the development and worsening of AKI [Acute kidney injury ] in ICU [intensive care unit ] patients with sepsis. PMID: 28332367
  50. Elevated cystatin C levels at admission were independently associated with impaired myocardial perfusion, poor cardiac functional recovery and development of congestive heart failure in patients with anterior STEMI undergoing PCI. PMID: 26498756
  51. Suggest that serum CysC level is an independent predictor of major adverse cardiovascular events, even in patients with preserved eGFR after elective sirolimus-eluting stent implantation. PMID: 25863806
  52. The concentration change of Cys C is better than serum creatinine as a biomarker in the early detection of Contrast-Induced Nephropathy. PMID: 27548357
  53. more closely associated with the presence of metabolic syndrome, as compared to serum creatinine PMID: 28272253
  54. Meta-analysis shows that Serum cystatin C is an early predictor of diabetic nephropathy among patients with diabetes mellitus PMID: 27889768
  55. Reprot increases in serum cystatin C that could erroneously be interpreted as acute kidney injury following cardiopulmonary bypass. PMID: 26396066
  56. a significant association of increased CysC levels with more advanced coronary artery disease, is reported. PMID: 28189145
  57. High cystatin C level is associated with kidney diseases. PMID: 27087511
  58. ADAMTS13 activity, d-Dimer and cystatin C are associated with retinopathy in type 1 diabetic patients and are promising biomarkers for the diagnosis and monitoring of diabetic retinopathy PMID: 27208743
  59. Data indicate that serum cystatin C is not a reliable early marker to efficiently predict renal failure in patients receiving chemotherapy. PMID: 28078200
  60. First-trimester cystatin C levels were significantly higher in cases complicated with preterm delivery and premature rupture of membrane (PROM) compared to uncomplicated ones (0.58+/-0.07 vs. 0.55+/-0.07, P=0.041, and 0.58+/-0.07 vs. 0.55+/-0.07, P=0.036). With a cutoff value of 0.505 mg/L, sensitivity of cystatin C for preterm delivery and PROM was 91.9% and specificity was 27.7%. PMID: 26356356
  61. Report reliability of using serum creatinine or/and cystatin C equations to estimate glomerular filtration rate. PMID: 26427030
  62. In mildly impaired renal function, serum cystatin C is a risk predictor of plaques and plaque burden. PMID: 27010456
  63. Serum cystatin-C levels revealed a significant negative correlation with estimated glomerular filtration rate . PMID: 26584598
  64. Estimated pre-liver transplant renal function is predictive of post-LT survival only when assessed using the CKD-EPI cystatin C equation. PMID: 26502295
  65. Cystatin C, a novel cardiac biomarker, predicts long-term mortality in patients with pulmonary hypertension and congenital heart disease. PMID: 26897077
  66. High activity of cathepsin B and increased level of cystatin C are typical for women in late pregnancy. Those levels significantly decrease after delivery which can be associated with potential role of those markers in placental separation PMID: 26904684
  67. findings suggest that both NGAL and CysC are very sensitive markers that reflect renal impairment in newly diagnosed patients with multiple myeloma. PMID: 26632077
  68. Cystatin C demonstrated incremental benefit in the prediction of response to cardiac resynchronization therapy. PMID: 26710332
  69. the A25T polymorphism does not cause a significant reduction in Cystatin C secretion, but instead predisposes the protein to be cleaved at an alternative signal sequence cleavage site. PMID: 26845025
  70. Cystatin C-based eGFR is a superior prognostic parameter to creatinine-based eGFR in post-endovascular therapy peripheral artery disease patients. PMID: 26354502
  71. Cystatin C expression was significantly downregulated in breast cancer cells with p53 mutations, and decreased cystatin C expression was associated with poor prognosis of breast cancer. PMID: 26757339
  72. the role of the cystatin C signal peptide in pathogenesis of AD and AMD PMID: 26865059
  73. Plasma Levels of Middle Molecules to Estimate Residual Kidney Function in Haemodialysis PMID: 26629900
  74. Results revealed that cystatin C deposition in Hereditary Cystatin C Amyloid Angiopathy is always spatially associated with arteries, i.e. parenchymal focal deposits were never seen in areas with no arteries PMID: 26115583
  75. Serum cystatin C reflects angiographic coronary collateralization in patients with stable coronary artery disease, and cystatin C >/= 0.97 mg/L indicates a great risk of poor coronary collaterals. PMID: 26402227
  76. the level of Cys-C in CSF should not be considered as a biomarker of ALS. Cys-C in serum may be useful as an indicator of the severity of disease and site of symptoms onset although the specificity of serum Cys-C levels in ALS was not significant. PMID: 26191245
  77. Postoperative serum Cys C appears to be a more specific and sensitive biomarker for NGAL-positive AKI resulting from cardiopulmonary bypass surgery in infants undergoing cardiac surgery. PMID: 25727405
  78. Data (including data from studies in mutant mice) suggest that up-regulation of CST3, as observed in plasma of mice with type 2 diabetes, down-regulates insulin signaling and promotes endoplasmic reticulum stress in hepatocytes but not in myotubes. PMID: 26592151
  79. Report role of serum cystatin C measurements in estimating kidney function in Japanese renal transplant recipients with mildly reduced or normal kidney function. PMID: 23670303
  80. Chronic kidney disease is a comorbidity that occurs frequently in COPD patients. Japanese COPD patients should preferably be evaluated based on creatinine in combination with cystatin C. PMID: 26185434
  81. cystatin C may be an indicator of acute PTE in patients with normal renal function. PMID: 24254896
  82. Cystatin C is a potential pathogenic signal triggering neurodegeneration in multiple system atrophy. PMID: 24405769
  83. Serum cystatin C has an important role in enhancing accuracy of GFR estimation of kidney function and predicting mortality in liver transplant recipients. PMID: 25654627
  84. Serum cystatin C may correlate with post-transplant kidney function. PMID: 27012045
  85. Corticosteroids given to heart failure patients can elevate serum cystatin C levels. PMID: 27012051
  86. Cystatin C plays a role in genetic susceptibility of cardiovascular diseases. PMID: 25589536
  87. Seru CST3 was lower in patients with coronary artery disease compared to controls. Decreased CST3 correlated with disease severity. PMID: 24979323
  88. The Cr/CysC ratio could serve as a useful predictive marker for chemotherapy-related adverse effects in patients with nonsmall-cell lung cancer. PMID: 26024878
  89. NGAL and cystatin C, known markers of renal injury, correlate with renal function decline in T1D, suggesting that they may be used as supplementary tests to urine albumin excretion in order to unmask early renal dysfunction. PMID: 25402375
  90. The detailed analysis of the docking results points to the fact that the best serum amyloid A-Cystatin C (SAA-hCC) binding is achieved by the peptides inclined toward interacting via Lys90 and Arg 96 (with ffhCC Ser98 and Tyr102, respectively). PMID: 25736604
  91. High serum cystatin C is associated with structural cardiac abnormalities. PMID: 25932809
  92. Elevated serum CysC in patients with acute ischemic stroke may play a protective role in ischemic injury. Under ischemic stimuli, neuronal cells, including neurons and astrocytes, may release high levels of CysC as a defensive mechanism to inhibit cysteine protease activity. PMID: 25697425
  93. In critically ill patients with acute kidney injury and sepsis, cystatin C is a reliable diagnostic biomarker. PMID: 25944130
  94. Nearly half of diabetic study participants with cystatin C >/= 1.12 mg/L have moderate diabetic retinopathy. PMID: 26576434
  95. Cystatin C changes are differentially present in the parkinsonian and cerebellar forms of multiple system atrophy and may play an important role in the pathogenesis of this neurodegenerative condition. PMID: 24606172
  96. Serum cystatin C, urine NAG, RBP, and ET-1 levels were found to be insufficient for the evaluation of SCD nephropathy. Increased B2M/creatinie levels can be valuable in estimating possible glomerular and tubular damage in SCD. PMID: 23987825
  97. Cystatin C may have a role in high blood pressure in elderly Chinese diabetics PMID: 26642700
  98. Cystatin C is a stronger predictor of postoperative renal dysfunction than serum creatinine, and its level is directly correlated with mid-term off-pump coronary artery bypass grafting adverse results. PMID: 26215986
  99. Measurement of cystatin C level in both diabetic and non-diabetic patients may reveal acute kidney injury earlier than NGAL and BUN PMID: 25832128
  100. In heart failure, the combination of NT-proBNP with estimated GFR using CysC-based CKD-EPI equations better predicts outcomes than either parameter alone and adds valuable complementary prognosis information to other established risk factors. PMID: 25663560

Show More

Hide All

Involvement in disease Amyloidosis 6 (AMYL6); Macular degeneration, age-related, 11 (ARMD11)
Subcellular Location Secreted
Protein Families Cystatin family
Tissue Specificity Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ov
Database Links

HGNC: 2475

OMIM: 105150

KEGG: hsa:1471

STRING: 9606.ENSP00000366124

UniGene: Hs.304682

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1