Recombinant Human DNA fragmentation factor subunit alpha (DFFA)

Code CSB-YP006737HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006737HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP006737HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP006737HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
DFFA
Uniprot No.
Alternative Names
A330085O09Rik; Caspase activated deoxyribonuclease inhibitor short form; DFF 1; DFF 45; DFF alpha; DFF-45; DFF1; DFF35; DFF45; DFFA; Dffa DNA fragmentation factor, alpha subunit ; DFFA_HUMAN; DNA fragmentation factor 45 kDa subunit; DNA Fragmentation Factor Alpha Subunit; DNA fragmentation factor subunit alpha; DNA fragmentation factor, 45 kD, alpha subunit ; DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1; DNA fragmentation factor, 45kDa, alpha polypeptide; DNA fragmentation factor, alpha subunit; DNAation factor 45 kDa subunit; H13; ICAD; ICAD L; ICAD S; Inhibitor of CAD; Inhibitor of Caspase Activated DNase; MGC143066; OTTHUMP00000001903 ; OTTHUMP00000001904 ; RP23 121D17.3
Species
Homo sapiens (Human)
Expression Region
1-331aa
Target Protein Sequence
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Protein Length
Full length of BC007721
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitor of the caspase-activated DNase (DFF40).
Gene References into Functions
  1. Glandular, menopause-independent DFF40, DFF45, and Bcl-2 overexpression may play an important role in the pathogenesis of endometrial polyps and benign endometrial hyperplasia PMID: 28914671
  2. evaluate the relative expression levels of miR-196a2 and three of its selected apoptosis-related targets; ANXA1, DFFA and PDCD4 in a sample of GI cancer patients PMID: 29091952
  3. Data show that the caspase-activated DNase (CAD) is activated when caspases cleave its endogenous inhibitor ICAD, resulting in the characteristic DNA laddering of apoptosis. PMID: 26106156
  4. Data suggest that DFF45 gene silencing, when applied in combination with doxorubicin, may offer a therapeutic strategy for the treatment of breast cancer. PMID: 24277473
  5. ICAD deficiency was associated with severe genomic instability. PMID: 23451280
  6. mRNA splicing is actively driven toward the pro-apoptotic isoforms of Bim, Bcl-x, and ICAD in Pnn-depleted MCF-7 cells. PMID: 22454513
  7. The DFF45 level in human endometrium corresponds to the respective phase of the menstrual cycle and decreases significantly after menopause. PMID: 22378161
  8. study reveals a previously unrecognized function of miR-145 in DFF45 processing, which may underlie crucial aspects of cancer biology PMID: 20687965
  9. The heterodimer, DFF40-DFF45, is localized to the chromatin fraction under apoptotic as well as non-apoptotic conditions. PMID: 19882353
  10. DFF45 at chromosome 1 reveal rare allelic variants in neuroblastoma tumors PMID: 11870543
  11. NMR solution structure of the C-terminal domain of DFF45, which is essential for its chaperone-like activity PMID: 12144788
  12. Hypoxia-induced cleavage of caspase-3 and DFF45/ICAD in human failed cardiomyocytes. PMID: 12181128
  13. subunit structures and stoichiometries in human cells before and after induction of apoptosis PMID: 12748178
  14. Hepatitis C virus core protein increases a steady-state level of ICAD protein, possibly through enhancing its promoter activity PMID: 14675622
  15. apoptotic DNA fragmentation factor is required for the maintenance of genetic stability and may play a role in tumor suppression PMID: 16432220
  16. plays an important and P53-independent role in maintaining chromosome stability and suppressing tumor development PMID: 16619042
  17. demonstrate the cellular mechanisms of neuronal cell degeneration induced via c-Jun-N-terminal kinases and caspase-dependent signaling PMID: 17645689
  18. C-terminal region of each subunit, DFF40 (RLKRK) and DFF45 (KRAR), is essential for nuclear accumulation of the DFF complex. PMID: 17938174
  19. Interestingly, nuclear DNA fragmentation occurred and consistently DNA fragmentation factor (DFF45)/Inhibitor of caspase-activated DNase (ICAD) was cleaved inside the cell as well as in vitro, suggesting a role of caspase-2 in nuclear DNA fragmentation. PMID: 17945178
  20. The highest level of DFF45 endometrial expression was found during the early secretory cycle phase, and significantly lower DFF45 expression was found in the endometrium during the mid-secretory as compared to the early secretory cycle phase. PMID: 18292826
  21. identified a TATA-less region upstream of the transcription start site as a basal promoter of the ICAD gene. An E-Box motif, which binds transcription factors of the basic helix-loop-helix/leucine zipper family, is responsible for transcriptional activity PMID: 18500556
  22. MPP(+) did not change the total levels of c-Jun but enhanced phosphorylation of c-Jun at Ser73 and cleavage of DNA fragmentation factor 45, which were diminished by selegiline. PMID: 18805449
  23. A decreased level of DFF45 observed in ovarian endometriosis may be a part of an apoptosis-resistant mechanism enhancing the disease progression. PMID: 19535198

Show More

Hide All

Subcellular Location
Cytoplasm.
Database Links

HGNC: 2772

OMIM: 601882

KEGG: hsa:1676

STRING: 9606.ENSP00000366237

UniGene: Hs.484782

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1