Recombinant Human Double homeobox protein 4(DUX4),partial

Code CSB-YP890667HU1
Size Pls inquire other sizes
Source Yeast
Code CSB-EP890667HU1
Size Pls inquire other sizes
Source E.coli
Code CSB-EP890667HU1-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Code CSB-BP890667HU1
Size Pls inquire other sizes
Source Baculovirus
Code CSB-MP890667HU1
Size Pls inquire other sizes
Source Mammalian cell

Product Details

Purity >85% (SDS-PAGE)
Target Names DUX4
Uniprot No. Q9UBX2
Species Homo sapiens (Human)
Expression Region 327-424aa
Target Protein Sequence AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
Protein Length Partial
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Q&A and Customer Reviews

 Q&A
Q:

I am interested in your DUX4 Recombinant Protein; E. coli (0.5mg) (cat#: CSB-EP890667HU), and I would like to know if you can meet the following requirements:
1)At least 1mg/mL for the concentration; but if you could reach 2mg/mL that would be great?
2)Can you provide the protein with a small tag like His-tag for purification? If not then a tag that is at least cleavable is fine? Because they need the protein for functional assays and the tags might interfere with such kind assays.
3)Can you provide removal of myc-tag?

A:
Thanks for your inquiry.
1) Regarding your requirement for the concentration, we can try to provide the concentration of 2mg/mL, if not, at least to guarantee 1mg/mL.
2) We can preferentially choose a small purification tag such as N-terminal His-Tag, if it's not suitable, we will try to remove the tag.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days. Please remark your requirements when placing the order.
3) We can guarantee to provide the protein without C-terminal tag, regarding the removal of N-terminal tag. we can try enzyme digestion, but we can't guarantee 100% successfully.
 Customer Reviews

Target Data

Function Involved in transcriptional regulation. May regulate microRNA (miRNA) expression.
Involvement in disease Facioscapulohumeral muscular dystrophy 1 (FSHD1)
Subcellular Location Nucleus
Protein Families Paired homeobox family
Tissue Specificity Does not seem to be expressed in normal muscle, but is detected in muscle of individuals with FSHD, and also in testis (at protein level) (PubMed:21060811). Does not seem to be expressed in normal muscle, but in muscle of individuals with FSHD, where it m
Database Links

HGNC: 50800

OMIM: 158900

KEGG: hsa:100288687

UniGene: Hs.728749

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.