Recombinant Human Double homeobox protein 4(DUX4),partial

Product Type Recombinant Protein
Uniprot No. Q9UBX2
Abbreviation DUX4
Species Homo sapiens (Human)
Gene Names DUX4
Protein Names Recommended name: Double homeobox protein 4Alternative name(s): Double homeobox protein 10 Double homeobox protein 4/10
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Involved in transcriptional regulation. May regulate microRNA (miRNA) expression.
Involvement in disease Facioscapulohumeral muscular dystrophy 1 (FSHD1)
Subcellular Location Nucleus
Protein Families Paired homeobox family
Tissue Specificity Does not seem to be expressed in normal muscle, but is detected in muscle of individuals with FSHD, and also in testis (at protein level) (PubMed:21060811). Does not seem to be expressed in normal muscle, but in muscle of individuals with FSHD, where it m
Database Links

HGNC: 50800

OMIM: 158900

KEGG: hsa:100288687

UniGene: Hs.728749

Product Details for Different Expression Systems

Product Name Recombinant Human Double homeobox protein 4(DUX4),partial,Yeast
Code CSB-YP890667HU1
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
Expression Region 327-424aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Double homeobox protein 4(DUX4),partial,E.coli
Code CSB-EP890667HU1
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
Expression Region 327-424aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Double homeobox protein 4(DUX4),partial,Baculovirus
Code CSB-BP890667HU1
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
Expression Region 327-424aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Double homeobox protein 4(DUX4),partial,Mammalian cell
Code CSB-MP890667HU1
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
Expression Region 327-424aa
Protein Description Partial
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

I am interested in your DUX4 Recombinant Protein; E. coli (0.5mg) (cat#: CSB-EP890667HU), and I would like to know if you can meet the following requirements:
1)At least 1mg/mL for the concentration; but if you could reach 2mg/mL that would be great?
2)Can you provide the protein with a small tag like His-tag for purification? If not then a tag that is at least cleavable is fine? Because they need the protein for functional assays and the tags might interfere with such kind assays.
3)Can you provide removal of myc-tag?

A:
Thanks for your inquiry.
1) Regarding your requirement for the concentration, we can try to provide the concentration of 2mg/mL, if not, at least to guarantee 1mg/mL.
2) We can preferentially choose a small purification tag such as N-terminal His-Tag, if it's not suitable, we will try to remove the tag.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days. Please remark your requirements when placing the order.
3) We can guarantee to provide the protein without C-terminal tag, regarding the removal of N-terminal tag. we can try enzyme digestion, but we can't guarantee 100% successfully.
Customer Reviews

Related Products

DUX4 Antibodies

DUX4 Antibodies for Human

DUX4 Antibodies for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.