Recombinant Human Epididymal secretory glutathione peroxidase(GPX5)

Code CSB-EP009870HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. O75715
Relevance Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Epididymis-specific glutathione peroxidase-like protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Research Area Signal Transduction
Source E.coli
Gene Names GPX5
Protein Names Recommended name: Epididymal secretory glutathione peroxidase EC= 1.11.1.9Alternative name(s): Epididymis-specific glutathione peroxidase-like protein Short name= EGLP Glutathione peroxidase 5 Short name= GPx-5 Short name=
Expression Region 1-100aa
Tag Info N-terminal 6xHis-Trx-tagged
Mol. Weight 28.4kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Subcellular Location Secreted
Protein Families Glutathione peroxidase family
Tissue Specificity Epididymis.
Database Links

HGNC: 4557

OMIM: 603435

KEGG: hsa:2880

STRING: 9606.ENSP00000392398

UniGene: Hs.248129

Pathway Th17 cell differentiation

Related Products

GPX5 Antibodies

GPX5 Antibodies for Homo sapiens (Human)

GPX5 Antibodies for Human

GPX5 Proteins

GPX5 Proteins for Homo sapiens (Human)

GPX5 ELISA Kit

GPX5 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.