Recombinant Human Estrogen receptor beta(ESR2),partial

Code CSB-EP007831HU1a2
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ESR2
Uniprot No. Q92731
Alternative Names ER BETA; ER-beta; Erb; ESR B; ESR BETA; ESR2; ESR2_HUMAN; ESRB; ESTRB; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; estrogen receptor 2 (ER beta); Estrogen receptor 2; estrogen receptor beta 4; Estrogen receptor beta; NR3A2; Nuclear receptor subfamily 3 group A member 2
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-323AA of Isoform 3
Target Protein Sequence DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 51.9kDa
Protein Length Partial of Isoform 3
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner
Gene References into Functions
  1. An association was found between the rs1256032 polymorphism of estrogen receptor beta gene and reduced risk in a Mexican population of developing type 2 diabetes. PMID: 29666032
  2. We identified a homozygous ESR2 variant, c.541_543del p.(Asn181del) in the highly conserved DNA-binding domain of ER-beta in an individual with syndromic 46,XY DSD. Two additional heterozygous missense variants, c.251G>T p.(Gly84Val) and c.1277T>G p.(Leu426Arg), located in the N-terminus and the ligand-binding domain of ER-beta, were found in unrelated, nonsyndromic 46,XY DSD cases. PMID: 29261182
  3. therapeutic activation of ERbeta elicits potent anticancer effects in Triple-negative breast cancer through the induction of a family of secreted proteins known as the cystatins, which function to inhibit canonical TGFbeta signaling and suppress metastatic phenotypes both in vitro and in vivo. PMID: 30257941
  4. ESR2 polymorphisms demonstrate minimal influence on Bone mineral density changes in women. PMID: 29320918
  5. Low ESR2 expression is associated with Tumor Progression in Colorectal Cancer with Familial Adenomatous Polyposis and Sporadic Polyps. PMID: 28681123
  6. The possible role of ESR2 G1730A variant as the risk factor of MI in a young age. PMID: 30036658
  7. TCF21 modulates Steroidogenic factor-1 and estrogen receptor beta expression through the recruitment of USF2 in endometriotic stromal cells. PMID: 30018006
  8. High phosphorylated ESR2 expression is associated with pancreatic ductal adenocarcinoma. PMID: 30046904
  9. FSHR rs6165, not ESR2 rs4986938, could be suggested as a candidate marker to predict poor ovarian response. PMID: 29036809
  10. There was a significant association between ERbeta RsaI and postmenopausal osteoporosis risk in both overall and Asian populations PMID: 29458346
  11. Estrogen receptor beta1 activation accelerates resistance to epidermal growth factor receptor-tyrosine kinase inhibitors in non-small cell lung cancer. PMID: 29328407
  12. Increased cytoplasmic ERbeta1 and nuclear ERbeta2 expression is associated with worse cancer specific outcomes following radical prostatectomy. These findings suggest that tumor ERbeta1 and ERbeta2 staining patterns provide prognostic information on patients treated with radical prostatectomy. PMID: 26804755
  13. ESR2 single nucleotide polymorphism is associated with poor ovarian response in Egyptian women undergoing IVF procedure. PMID: 28825151
  14. ERbeta expression conferred cell sensitivity, as patient-derived AML cells with high levels of ERb were sensitive, whereas cells with low ERb were insensitive to diosmetin. Knockdown of ERb confirmed resistance, whereas overexpression enhanced sensitivity to diosmetin, which was demonstrated to be mediated by reactive oxygen species signaling. PMID: 28835383
  15. Data report for the first time that ERbeta inversely regulates miR-10b and miR-145, which are critical modulators of functional properties, epithelial to mesenchymal transition and extracellular matrix composition of breast cancer cells. ERbeta together with miR-10b and miR-145, are key players for the initiation of breast cancer cell aggressiveness. PMID: 28797712
  16. the mRNA expression levels of ERbeta isoforms are downregulated in sporadic colorectal cancer and in FAP individuals. T3/T4 tumours also presented decreased expression of ERbeta. Additionally, the expression levels of ERbeta1 and ERbeta5 were associated with the probability of disease-free survival. PMID: 29132333
  17. factors that regulate the alternative splicing of ERs remain unknown. We demonstrate novel evidence supporting a potential biological feedback loop where 17beta-estradiol regulates the RNA-binding protein Nova1, which, in turn, regulates the alternative splicing of ERbeta PMID: 29031089
  18. A dual role of the association between AGO2 and ERbeta in luminal-like breast cancer cells in the nucleus and the cytoplasm, for the regulation of gene expression at both the transcriptional and post-transcriptional level. PMID: 29017520
  19. We found higher nuclear (n)ERalpha and nERbeta5 and lower cytoplasmic (c)ERalpha expression in advanced ovarian cancers. Lower ERbeta1 expression was also detected in high grade cancers. Loss of nERalpha and cERbeta2 expression were observed in clear cell histological subtypes. Higher nERbeta5 and lower cERbeta5 expression were associated with serous/clear cell subtypes, poor disease-free and overall survival. PMID: 28859612
  20. We found little overall difference in the DNA methylation of the ESR2 5'-flanking region in individuals with autism compared with normal individuals. PMID: 28299627
  21. our data reveal a novel mechanism for ERbeta's anti-proliferative and pro-apoptotic effects in breast cancer cells involving p53 and epigenetic changes in histone methylation that underlie gene regulation of these cellular activities. PMID: 28577282
  22. loss of ERbeta function acts in collaboration with p53 inactivation to induce early onset of mammary tumors with spindle cell morphology and more basal-like characteristics. PMID: 28673316
  23. Low levels of ESR2 is associated with metastasis in triple-negative breast cancer. PMID: 28583190
  24. Findings from the systematic review and meta-analysis suggest that rs1256120 of ESR2 is unlikely to be a predisposing or disease-modifying genetic risk factor for adolescent idiopathic scoliosis. PMID: 27755497
  25. High concentrations of DINCH urinary metabolites activate human ESR2 receptors. PMID: 29421333
  26. Tumor ERbeta1 expression was available for 911 breast cancer patients and was not associated with ESR2 genotypes. High tumor ERbeta1 expression is a marker of good prognosis in breast cancer, especially among chemotherapy-treated patients, but not in endocrine therapy-treated patients. PMID: 27810901
  27. Targeting ERbeta with selective agonists might affect Hodgkins lymphoma cell proliferation and tumor growth via a mechanism that brings into play DRAM2-dependent autophagic cascade. PMID: 28052027
  28. ERbeta might be the target protein of arctigenin responsible for inhibition of mTORC1 activation and resultant prevention of Th17 cell differentiation and colitis development. PMID: 27863380
  29. Data suggest that the ERalpha-H19-BIK signaling axis plays an important role in promoting breast cancer cell chemoresistance. PMID: 27845892
  30. fulvestrant up-regulated ERbeta in ERalpha+/ERbeta+ breast cancer and in triple negative ERbeta+ breast cancers (ERalpha-/ERbeta+) PMID: 27486755
  31. ERbeta plays a crucial role in the cell behavior and extracellular matrix composition of the highly aggressive MDA-MB-231 cells. PMID: 27179695
  32. Study provides evidence for a critical role of ESR2 in radio-resistance of in head and neck squamous cell carcinoma, and that SMR3A might serve as a surrogate marker for active ESR2 signaling. PMID: 28166815
  33. This study demonstrated that ESR2 but not ESR1 minor alleles were associated with lower cognitive performance in elderly women with an indication of a gene-gene interaction with APOEepsilon4. And also found indications for gene-environment interactions of ESR2 with traffic-related air pollution exposure on cognitive performance. PMID: 27629499
  34. LY500307 is a highly selective estrogen receptor beta agonist, which loses its selectivity at high dose and leads to undesirable suppression of total testosterone concentration. PMID: 27136911
  35. ERbeta ubiquitination, protein turnover, and inhibition of breast cancer is regulated by tyrosine phosphorylation PMID: 27323858
  36. ERbeta in both normal and cancerous colon epithelial cells upregulates miRNA-205, which subsequently reduces PROX1 through direct interaction with its 3'UTR PMID: 27283988
  37. Membrane estrogen receptor beta and GPER signaling mediate cellular responses to environmentally relevant concentrations of CdCl2 and NaAsO2 in lung adenocarcinoma cells. PMID: 27071941
  38. C-Jun and CREB are recruited to ESR2 or CYP19A1 promoter by IGF-I stimulation. PMID: 26899323
  39. increases in ERbeta and p53 immunoreactivity were significantly correlated with the incidence of metastasis and/or recurrence in endometrial endometrioid carcinoma PMID: 29190668
  40. Low estrogen receptor beta is associated with triple-negative breast cancer. PMID: 26871946
  41. The variation at rs10144225 in ESR2 was associated with salt-sensitive blood pressure (SSBP) in premenopausal women (estrogen-replete) and not in men or postmenopausal women (estrogen-deplete). Inappropriate aldosterone levels on a liberal salt diet may mediate the SSBP. PMID: 28938457
  42. Data suggest that 17-beta-estradiol/ESR2 signaling counteracts TNFA-induced, inflammation-mediated apoptosis of vascular endothelial cells in a mechanism that requires NOTCH1-mediated Akt phosphorylation. (ESR2 = estrogen receptor 2; TNFA = tumor necrosis factor-alpha; NOTCH1 = Notch homolog 1, translocation-associated protein) PMID: 28893903
  43. Expression of ERbeta and p53 significantly correlated with age and advanced cancer stages, and the p53-negative EOGC was associated with favorable outcomes. PMID: 27781410
  44. Our data suggest that oestrogens stimulated osteogenic differentiation in human dental pulp cells and that this action is mediated principally through the ERbeta isoform PMID: 29031686
  45. ESR2 may modify the interaction between negative life events and MDD in the Chinese Han menopausal females. PMID: 27814959
  46. Results show that ERb is upregulated in bladder malignant tissue, and its expression is associated with muscle-invasive disease. PMID: 27324053
  47. estrogen may play a role in androgen-independent prostate cancer cell proliferation through a novel pathway, involving ERbeta-mediated activation of beta-catenin. PMID: 27107935
  48. ERbeta immunoreactivity was markedly present in all the cases of Merkel cell carcinoma examined. significant correlation with Ki-67 labeling index and Bcl-2 score suggest that ERbeta could be associated with regulation of both cell proliferation and apoptosis in MCCs. PMID: 27343835
  49. Germline ESR2 mutation is associated with medullary thyroid carcinoma. PMID: 26945007
  50. Exposure to the combination of 100 muM genistein and 10 nM calcitriol reduced the number of proliferative cells to control levels, increased ERb and VDR expression, and reduced extracellular acidification (40%) as well as respiratory activity (70%), primarily in MG-63 cells..strong overexpression SGPL1, which irreversibly degrades sphingosine-1-phosphate thereby, generating ethanolamine PMID: 28125641
  51. Primary and secondary phthalate metabolites appear to exert different effects on ESR2 receptors. PMID: 28571686
  52. Genetic variations in ESR2 gene are significantly associated with survival in patients with locally advanced gastric cancer. PMID: 26503819
  53. ESR2 genetic polymorphisms were associated with the risk of first-ever stroke in Chinese women, and the AA genotype of rs4986938 combined with COC use could significantly increase the risk of hemorrhagic stroke. PMID: 28625324
  54. The present study systematically evaluated the genetic effect of the estrogen metabolic pathway on alzheimer's based on 78 polymorphisms distributed across four genes. In the southern Chinese population, strong evidence of associations with AD were detected for polymorphisms in ESR2 and CYP11A1. PMID: 28102888
  55. this article indicates a novel functional interplay between estrogen receptor beta and sirtuin-3 counteracting reactive oxygen species production in TCam-2 cells. Our findings thus show that an important tumor-suppressive pathway through estrogen receptor beta is target of E2, actually proposing a distinctive protecting action against seminoma. PMID: 28459202
  56. Associations in women between face recognition and variation in ESR2. PMID: 26955855
  57. Both estrogen receptor Beta and androgen receptor levels decline gradually with intrinsic and extrinsic skin aging. PMID: 27399919
  58. Results of this study indicated that HTR4 signaling upregulated ERbeta expression in hormone-naive prostate cancer and could impact on biological processes in hormone-naive prostate cancer. PMID: 28195088
  59. Data show that low estrogen receptor beta (ERbeta) expression was significantly correlated with local recurrence and distant metastasis. PMID: 27052470
  60. Positive results were found in 15 situations when genes were analyzed in groups of 3; the most significant result corresponded to polymorphisms of p53, ERb and GSTM1 seen in 20%; PROGINS, ERb and GSTM1 in 18%; and p53, ERb and PROGINS in 12% patients., while 31.25% patients showed GSTM1- PROGINS and GSTT1-CYP1A1 polymorphism PMID: 27323100
  61. Our findings suggested that in Egyptian population, genetic mutation in ERss is associated with the risk of nonobstructive azoospermia. PMID: 27038350
  62. The expression of c-Met and ERbeta were significantly related to the basal-like phenotype in triple-negative breast cancer, however, high c-Met expression and basal-like phenotypes did not show a direct correlation with poor prognosis PMID: 26968553
  63. Estrogen receptor beta gene polymorphism is associated with uterine leiomyomas. PMID: 26715264
  64. the risk for developing urodynamic stress urinary incontinence among pelvic organ prolapse patients seems to be strongly associated with the reduction of both estrogen receptors (ER-alpha and ER-beta) expression PMID: 25714872
  65. ER-beta expression decreased in duodenal familial adenomatous polyposis. PMID: 27003997
  66. MMP-19 is an estrogen receptor beta target gene, where ERbeta requires a specific Sp1 site on the MMP-19 promoter to mediate ligand dependent transcription. PMID: 26700939
  67. Our results revealed increased miR-92 expression and decreased ERbeta1 level in uterosacral ligaments of women diagnosed with pelvic organ prolapse PMID: 26803387
  68. ESR2 rs1256030 T allele may be a significant risk factor for the development of PBC. PMID: 26608979
  69. Cryptotanshinone and wogonin up-regulate eNOS in vascular endothelial cells via ERalpha and down-regulate iNOS in LPS stimulated vascular smooth muscle cells via ERbeta. PMID: 26481132
  70. Analysis of SNPs and haplotypes in the IL10 and SNP in the ESR2 gene did not present any significant association with aggressive periodontitis or chronic periodontitis. PMID: 27737359
  71. Aabnormal methylation of the estrogen receptor beta promoter may increase genetic susceptibility to prostate cancer. PMID: 26547439
  72. Infiltrating T cells regulate ERbeta/DAB2IP signals in renal cell carcinoma. PMID: 26587829
  73. Reduction of estrogen receptor beta expression is associated with inflammatory bowel disease. PMID: 26497217
  74. Data shows that ESR2 is expressed in more that 50% of normal mammary epithelial cells, in 10% in invasive ductal carcinoma, and 61% of tumor infiltrating leucocytes. Lobular breast neoplasm expresses high levels of both ESR1 and ESR2. [review] PMID: 25433206
  75. Data show that estrogen receptor beta (ERbeta) functions as a repressor of hypoxia-inducible factor 1, alpha subunit (HIF-1alpha)-mediated NF-kappa B (NF-kB) activation. PMID: 26450901
  76. ERbeta may be a useful biomarker for risk stratification and a novel therapeutic target for breast cancer risk reduction PMID: 26276747
  77. Estrogen receptor Beta-positive cases of squamous cell lung carcinoma were at risk for poor outcome. PMID: 26678909
  78. Findings of the current study suggest that the ER-beta gene polymorphisms are not major determinants of the development of recurrent pregnancy loss in Korean women. PMID: 26287523
  79. The greater the levels of ER-beta expression, tissue inflammation, and angiogenesis are, the more severe de Quervain's disease is. ER-beta might be a useful target for novel de Quervain's disease therapy. PMID: 26556342
  80. autocrine IFN-g in MCF-7 increases mRNA expression of ERb resulting in enhanced sensitivity to tamoxifen (TAM). These results indicate that ERbetaand autocrine IFN-g represent two putative targets for breast cancer therapy. PMID: 26397740
  81. The RsaI polymorphism in ERbeta is associated with male infertility in Caucasian patients. The aim of this study was to investigate the frequency of this polymorphism in the etiology of idiopathic male infertility PMID: 26400324
  82. Data show that oxytocin receptor and estrogen receptor beta single nucleotide polymorphisms (SNPs) temper accelerated cellular aging in young females who tend to make impatient choices. PMID: 26903639
  83. Intracellular lactate induces estrogen receptor beta expression in biphasic malignant pleural mesothelioma cells. PMID: 26208479
  84. obesity-associated systemic factors suppress ERbeta expression in breast cancer cells via a HER2-mediated pathway PMID: 26709918
  85. Data show that ER-b is highly expressed in Urothelial cell carcinoma specimens treated with cystectomy and that marked ER-b intensity was associated with good prognostic features. PMID: 25981333
  86. Taken together, silibinin induced apoptosis through mitochondrial pathway by up-regulating ERbeta pathways in MCF-7 cells without the involvement of autophagy. PMID: 26767948
  87. Period 1 and estrogen receptor-beta are downregulated in Chinese colon cancers. PMID: 26339386
  88. Suggest that the expression of ERbeta2 in papillary thyroid cancer is associated with disease progression. PMID: 26261608
  89. Data indicate that estrogen receptor beta (ERbeta) expression plays an important role in the response of cancer cells to cytotoxic agents, especially for cisplatin treatment. PMID: 26232188
  90. ERbeta expressed in cytoplasm may mediate pathogenesis of EMs. PMID: 27048022
  91. rs58262369 is associated with prostate cancer susceptibility in Asians. mRNA levels of ESR2 are differentially expressed in prostate tumours and paired normal tissues. PMID: 26443449
  92. that estrogen biphasically modulates prostate tumor formation by regulating Kruppel-like zinc finger transcription factor 5-dependent transcription through estrogen receptor beta PMID: 26483416
  93. The identification of cytoplasmic proteins interacting with estrogen receptor beta in breast cancer cells PMID: 25604459
  94. These findings suggest that at least part of the oncogenic effects of ERbeta2 is mediated by HIF-1alpha and that targeting of this ERbeta2 - HIF-1alpha interaction may be a strategy to treat prostate cancer. PMID: 26010887
  95. ERbeta1 inversely correlates with PTEN/PI3K/AKT pathway and predicts a favorable prognosis in triple-negative breast cancer PMID: 26070269
  96. cell proliferation was possibly mediated by nuclear ERb through other pathways, GPR30 probably did not exert the key roles in the cells unless its expression level or the ratio of the two receptors reached a crucial level. PMID: 26090392
  97. ERa mRNA and protein levels of in multiple leiomyomas were significantly lower than those of solitary leiomyomas, whereas ERb. PMID: 26529545
  98. ESR2 mRNA expression was significantly lower on granulosa cells of PCOS patients compared to controls. PMID: 25603724
  99. Activation of AKR1C1/ERbeta induces apoptosis by downregulation of c-FLIP in prostate cancer cells. PMID: 25816367
  100. Loss of ER beta expression is associated with prostate carcinomas. PMID: 25527409

Show More

Hide All

Subcellular Location Nucleus
Protein Families Nuclear hormone receptor family, NR3 subfamily
Tissue Specificity Isoform 1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, b
Database Links

HGNC: 3468

OMIM: 601663

KEGG: hsa:2100

STRING: 9606.ENSP00000343925

UniGene: Hs.660607

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1