Recombinant Human G antigen 13 (GAGE13)

Code CSB-YP009178HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009178HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009178HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP009178HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP009178HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
GAGE13
Uniprot No.
Alternative Names
GAGE13; GAGE12AG antigen 13; GAGE-13; G antigen 12A; GAGE-12A
Species
Homo sapiens (Human)
Expression Region
1-117
Target Protein Sequence
MSWRGRSTYY RPRPRRYVEP PEMIGPMRPE QFSDEVEPAT PEEGEPATQC QDPAAAQEGE DEGASAGQGP KPEADSQEQG HPQTGCECED GPDGQEMDPP NPEEVKTPEE GKKQSQC
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interested in the following proteins expressed in mammalian with a concentration of 50ug/ml. Please let me know if this is possible for the following products:
We would also like to know if it’s possible to buy some of the antigen resuspension buffer you use?
We will be using these proteins to build a protein array for serum profiling and are unsure if they need aseptic processing or endotoxin removal?
Can you please advise whether this is necessary? We would like these proteins in eukaryotic host instead with a concentration of 50ug/ml.
CSB-MP009188HU
CSB-MP768782HU
CSB-MP013325HU
CSB-MP887003HU
CSB-MP013348HU
CSB-MP636766XBF
CSB-MP897569HU
CSB-MP009178HU
CSB-MP664879BO

A:
1.Thanks for your inquiry.
Recombinant Human G antigen 13(GAGE13)
CSB-YP009178HU >> Yeast
CSB-EP009178HU >> E.coli
CSB-BP009178HU >> Baculovirus
CSB-MP009178HU >> Mammalian cell
Expression Region: 1-117aa; Full length.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP: N-terminal GST-tagged; BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

MSWRGRSTYYWPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC


2. As you want these proteins expressed in mammalian with a concentration of 50ug/ml, generally the concentration for MP protein is 0.1-0.5mg/ml (100ug/ml-500ug/ml),
The concentration of 50ug/ml is a little low, the low concentration is not very good for the protein stability, so we recommend the concentration is better higher than 0.1mg/ml.
3. You would also like to know if it’s possible to buy some of the antigen resuspension buffer you use?
How much do you need for the buffer ? If it's not too much, we can provide some for free, such as 5ml or 10ml.
4.You will be using these proteins to build a protein array for serum profiling and are unsure if they need aseptic processing or endotoxin removal?
Can you please advise whether this is necessary? You would like these proteins in eukaryotic host instead with a concentration of 50ug/ml.
According to your application, they don't need aseptic processing or endotoxin removal.
Do you mean that the concentration of 50ug/ml is not necessary, as long as these proteins are expressed in eukaryotic host ?
If yes, we recommend the concentration is better higher than 100ug/ml, and you can choose any eukaryotic expression systems. (YP, BP, MP)
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1