Recombinant Human HLA class I histocompatibility antigen, alpha chain G(HLA-G)

In Stock
Code CSB-MP010509HU
Size US$3696Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP010509HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens(Human) HLA-G.
  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP010509HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens(Human) HLA-G.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names HLA-G
Uniprot No. P17693
Alternative Names HLA G antigen;MHC class I antigen G
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 25-338aa
Target Protein Sequence GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

I am interested in your product ​​#CSB-MP010509HU, Recombinant Human HLA class I histocompatibility antigen, alpha chain G(HLA-G)
​​Could you let us know the gene introduction method to mammalian cell?

A:
Thanks for your inquiry.
1.Generally, the mammalian cells used to produce the protein is HEK 293, however, the CHO cells are also available if you have this request.
2.The transfection method used to introduce the gene into the host cell is transient transfection.
3.No virus expression system is used for this protein CSB-MP010509HU expression.
4.The commonly used vector is psectag 2A his/myc vector.
Q:

Thank you for sending the product. Unfortunately, on processing the stock we found the following discrepancy: * Product: CSB-MP010509HU (1.00mg) Recombinant Human HLA G protein (His tag) Lot number: 03853 Number of units ordered: 1 Number of units received: 1 x 1mg @ 0.15 mg/ml After centrifuging the product and then checking the content, we found that instead of the expected 6.67ml per vial, the vial received was short by 1ml. Could you please arrange for a free of charge replacement or top-up from the same lot number to compensate for this discrepancy? Many thanks in advance.

A:
Thank you for your e-mail.
I checked with our tech team. 
Would it be possible for you to send us a photo of your received tube? Could you please kindly check whether the tube breaks or not? 
If leakage is found, we could resend extra 150ug for free to make up for this loss.
If no leakage is found, because the 1mg protein was in a 10ml volume tube. Generally there is residual on the wall of tube. Could you please check it again? We could also resend extra 150ug for free after recieving your confirmation. 
Our tech team also informs that this protein was ordered frequently lately, it is out of stock. It is under production now, but lead time will be 15-20 business days. 
 Customer Reviews

Target Data

Function Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted, SUBCELLULAR LOCATION: Isoform 7: Secreted
Protein Families MHC class I family
Tissue Specificity Expressed in trophoblasts. Expressed in fetal eye and thymus (PubMed:2336406). Also expressed in adult eye (PubMed:1570318). Isoform 4: Expressed in fetal first trimester trophoblasts (PubMed:7589701). Isoform 7: Expressed in first trimester, second trime
Database Links

HGNC: 4964

OMIM: 142871

KEGG: hsa:3135

STRING: 9606.ENSP00000353472

UniGene: Hs.512152

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.