Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4(ITIH4),partial

Code 617923HU
Product Type Recombinant Protein
Size
Uniprot No. Q14624
Abbreviation ITIH4
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity >85% (SDS-PAGE)
Sequence RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Source Baculovirus
Gene Names ITIH4
Protein Names Recommended name: Inter-alpha-trypsin inhibitor heavy chain H4 Short name= ITI heavy chain H4 Short name= ITI-HC4 Short name= Inter-alpha-inhibitor heavy chain 4Alternative name(s): Inter-alpha-trypsin inhibitor family heavy chain-
Expression Region 689-930aa
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Subcellular Location Secreted
Protein Families ITIH family
Tissue Specificity Liver specific.
Database Links

HGNC: 6169

OMIM: 600564

KEGG: hsa:3700

STRING: 9606.ENSP00000266041

UniGene: Hs.709406

Related Products

ITIH4 Antibodies

ITIH4 Antibodies for Human

ITIH4 Antibodies for Homo sapiens (Human)

ITIH4 Proteins

ITIH4 Proteins for Homo sapiens (Human)

ITIH4 ELISA Kit

ITIH4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.