Recombinant Human Lymphocyte antigen 6H(LY6H)

Code CSB-YP013249HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. O94772
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Short name: Ly-6H
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG
Research Area Cell Biology
Source Yeast
Gene Names LY6H
Protein Names Recommended name: Lymphocyte antigen 6H Short name= Ly-6H
Expression Region 26-115aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity Highly expressed in brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. Also found in lower levels in testis, pancreas, small intestine and colon.
Database Links

HGNC: 6728

OMIM: 603625

KEGG: hsa:4062

STRING: 9606.ENSP00000342711

UniGene: Hs.159590

Related Products

LY6H Antibodies

LY6H Antibodies for Human

LY6H Antibodies for Homo sapiens (Human)

LY6H Proteins

LY6H Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.