Recombinant Human Melanoma-associated antigen 1(MAGEA1)

Code CSB-YP013323HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P43355
Relevance May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in bryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP013323HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MAGEA1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP013323HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MAGEA1.
Storage Buffer Tris-based buffer,50% glycerol
Alias Antigen MZ2-ECancer/testis antigen 1.1 ;CT1.1MAGE-1 antigen
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV
Research Area Cancer
Source Yeast
Gene Names MAGEA1
Protein Names Recommended name: Melanoma-associated antigen 1 Alternative name(s): Antigen MZ2-E Cancer/testis antigen 1.1 Short name= CT1.1 MAGE-1 antigen
Expression Region 1-309aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 36.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Subcellular Location Cytoplasm, Nucleus
Tissue Specificity Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
Database Links

HGNC: 6796

OMIM: 300016

KEGG: hsa:4100

STRING: 9606.ENSP00000349085

UniGene: Hs.72879

Q&A and Customer Reviews

Q&A
Q:

Could you please let me know the full sequence, including tags, of CSB-EP013323HU and CSB-YP013323HU MAGE A1?
I am wondering why, despite being the same protein, I run at different MWs.

A:
Thanks for your inquiry. Our replies are as below.
1. CSB-EP013323HU N-terminal 10xHis-tagged MW of the Tag: 5.5 KDa Tag Sequence:

MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSEFHHHHHHHHHHLVPRGSRT


2. CSB-YP013323HU N-terminal 6xHis-tagged MW of the Tag: 2 KDa Tag Sequence:

EAEAYVHHHHHHEFRT


3. The MW of the target protein is 34.3 KDa. The target protein sequence is as follows.

MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV


The MW of fusion protein CSB-EP013323HU: 5.5KD+34.3KD= 39.8 KD
The MW of fusion protein CSB-YP013323HU: 2KD+34.3KD= 36.3KD
The vectors used for EP and YP are different, and the tag sequences contain part of the vector sequence, so their MW are different.
Customer Reviews

Related Products

MAGEA1 Antibodies

MAGEA1 Antibodies for Homo sapiens (Human)

MAGEA1 Antibodies for Human

MAGEA1 Proteins

MAGEA1 Proteins for Homo sapiens (Human)

MAGEA1 ELISA Kit

MAGEA1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.