Recombinant Human Melanoma-associated antigen 1(MAGEA1)

Code CSB-YP013323HU
Size US$2010
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP013323HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MAGEA1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP013323HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MAGEA1.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names MAGEA1
Uniprot No. P43355
Research Area Cancer
Alternative Names Antigen MZ2-ECancer/testis antigen 1.1 ;CT1.1MAGE-1 antigen
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-309aa
Target Protein Sequence MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 36.3kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

Could you please let me know the full sequence, including tags, of CSB-EP013323HU and CSB-YP013323HU MAGE A1?
I am wondering why, despite being the same protein, I run at different MWs.

A:
Thanks for your inquiry. Our replies are as below.
1. CSB-EP013323HU N-terminal 10xHis-tagged MW of the Tag: 5.5 KDa Tag Sequence:

MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSEFHHHHHHHHHHLVPRGSRT


2. CSB-YP013323HU N-terminal 6xHis-tagged MW of the Tag: 2 KDa Tag Sequence:

EAEAYVHHHHHHEFRT


3. The MW of the target protein is 34.3 KDa. The target protein sequence is as follows.

MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV


The MW of fusion protein CSB-EP013323HU: 5.5KD+34.3KD= 39.8 KD
The MW of fusion protein CSB-YP013323HU: 2KD+34.3KD= 36.3KD
The vectors used for EP and YP are different, and the tag sequences contain part of the vector sequence, so their MW are different.
 Customer Reviews

Target Data

Function May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Subcellular Location Cytoplasm, Nucleus
Tissue Specificity Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
Database Links

HGNC: 6796

OMIM: 300016

KEGG: hsa:4100

STRING: 9606.ENSP00000349085

UniGene: Hs.72879

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.