Recombinant Human Melanoma-associated antigen 1 (MAGEA1)

In Stock
Code CSB-YP013323HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP013323HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MAGEA1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP013323HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) MAGEA1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MAGEA1
Uniprot No.
Research Area
Cancer
Alternative Names
Antigen MZ2 E; Antigen MZ2-E; Cancer/testis antigen 1.1; cancer/testis antigen family 1, member 1; CT1.1; MAGA1_HUMAN; MAGE 1 antigen; MAGE-1 antigen; MAGE1; MAGE1A; MAGEA1; Melanoma antigen 1; Melanoma antigen family A 1 (directs expression of antigen MZ2 E); Melanoma antigen family A 1; Melanoma antigen MAGE 1; Melanoma associated antigen 1; Melanoma associated antigen MZ2 E; Melanoma-associated antigen 1; MGC9326
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-309aa
Target Protein Sequence
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
36.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you please let me know the full sequence, including tags, of CSB-EP013323HU and CSB-YP013323HU MAGE A1?
I am wondering why, despite being the same protein, I run at different MWs.

A:
Thanks for your inquiry. Our replies are as below.
1. CSB-EP013323HU N-terminal 10xHis-tagged MW of the Tag: 5.5 KDa Tag Sequence:

MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSEFHHHHHHHHHHLVPRGSRT


2. CSB-YP013323HU N-terminal 6xHis-tagged MW of the Tag: 2 KDa Tag Sequence:

EAEAYVHHHHHHEFRT


3. The MW of the target protein is 34.3 KDa. The target protein sequence is as follows.

MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV


The MW of fusion protein CSB-EP013323HU: 5.5KD+34.3KD= 39.8 KD
The MW of fusion protein CSB-YP013323HU: 2KD+34.3KD= 36.3KD
The vectors used for EP and YP are different, and the tag sequences contain part of the vector sequence, so their MW are different.

Target Background

Function
May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Gene References into Functions
  1. The expression of MAGE-A genes in peripheral blood may act as a poor prognostic marker in patients with lung cancer. PMID: 29430849
  2. MAGE-A expression in blood or bone marrow at tumor surgery is an independent predictor of survival in resected non-small cell lung cancer PMID: 27542766
  3. Authors revealed a novel interaction between MAGEA1 and the intracellular segment of NOTCH1 receptor (NICD1). MAGEA1 reduced NICD1's stability by promoting the ubiquitin modification of NICD1. PMID: 28459460
  4. In patients with Colon cancer, the expression of MAGE-A(1-6) gene was associated with a poor prognosis. PMID: 28631709
  5. MAGEA1 was expression in 15% of synovial sarcomas and was not associated with prognosis. PMID: 27993576
  6. Data show that overall survival (OS) was significantly lower for patients expressing pan-MAGE or MAGE-A1/A3/A4 in both independent cohorts. PMID: 28146422
  7. These data demonstrate that MAGE-A1-, MAGE-A3-, and NY-ESO-1-specific T cells with antigen-specific cytotoxicity can be cultured from healthy donors and patient-derived cells making adoptive immunotherapy with these cytotoxic T lymphocyte feasible. PMID: 28677424
  8. up-regulation of MAGE-A1 dramatically promoted proliferation, migration, and invasion of human melanoma cell lines in vitro PMID: 27045082
  9. The overall survival of laryngeal squamous cell carcinoma patients with positive MAGE-A1, MAGE-A9, or MAGE-A11 expression was lower than the patients without MAGE-A1, MAGE-A9, or MAGE-A11 expression. PMID: 26766421
  10. MAGE-A is more highly expressed than NY-ESO-1 in a majority of human malignancies PMID: 27070449
  11. TRIM31 directly binds to NSE4, suggesting the existence of a TRIM31-MAGEA1-NSE4 complex reminiscent of the NSE1-NSE3-NSE4 trimer. PMID: 25590999
  12. Differential regulation of MAGE-A1 promoter activity by BORIS and Sp1, both interacting with the TATA binding protein. PMID: 25363021
  13. DNA methylation has a dominant role in the epigenetic hierarchy governing MAGEA1 expression PMID: 23472218
  14. results show the absence and/or low expression of MAGE A1 transcripts in oral squamous cell carcinoma; presence of hypomethylation at a small level at the promoter site of MAGE A1 was detected in both oral squamous cell carcinoma and normal oral mucosa PMID: 22447174
  15. Report MAGEA1-A6 expression in sputum suggests presence of lung cancer cells or precancerous cells. PMID: 22134685
  16. High MAGE-1 is associated with differentiated advanced gastric cancer. PMID: 21042944
  17. MAGE1 expression mediated by demethylation of MAGE1 promoter induce progression of non-small cell lung cancer. PMID: 21273595
  18. CCL3 and CCL20-recruited dendritic cells modified by melanoma antigen gene-1 have a role in anti-tumor immunity against gastric cancer PMID: 20420712
  19. Tumor-specific antigen MAGE may play a role in the occurrence and development of ovarian cancerc and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer. PMID: 20423514
  20. MAGE-A peptides and HLA class I molecules are expressed in hepatocellular carcinoma PMID: 20592351
  21. The high expression rates of MAGE-1 and MAGE-3 genes in IHCC suggests the MAGE-1 and MAGE-3 gene may be a target for immunotherapy in IHCC patients. PMID: 18505125
  22. Since 37% of patients with operable NSCLC harbored disseminated tumor cells that expressed MAGE-A, only these patients might benefit from adjuvant immunotherapies directed against MAGE-A1 to -A6. PMID: 19467731
  23. The MAGE-A1 gene expression is not determined solely by methylation status of the promoter region in hematological malignancies. PMID: 12443884
  24. Spontaneous in vivo priming of MAGE-specific T cell response and high frequency of MAGE1 and MAGE3 expression in hepatocellular carcinoma makes this antigen potential candidate for MAGE-specific immunotherapy in hepatocellular carcinoma. PMID: 14672620
  25. MAGE-A1 can function as a potent transcriptional repressor via interactions with Ski Interacting Protein and the deacetylase HDAC1. PMID: 15316101
  26. a novel sequence-specific DNA-protein interaction at the -30 CpG dinucleotide upstream of the gene was found having a vital part to play in the DNA methylation mediated transcription silencing of the MAGE-A1 gene PMID: 15353125
  27. Present, by immunocytochemistry, in normal prostate, prostatic hypertrophy and prostate cancer. PMID: 16114059
  28. down-regulation of DNMT1 methyltransferase leads to activation and stable hypomethylation of MAGE-A1 in melanoma cells PMID: 16497664
  29. Detection of aberrant methylation patterns of MAGEs CpG islands using Methylation-special PCR may be useful for diagnosis of Hepatocellular Carcinoma. PMID: 16516880
  30. The promoter hypomethylation of MAGE-A1 and MAGE-A3 genes up-regulates its expression in colorectal carcinomas as well as in gastric cancers and might play a significant role in the development and progression of human colorectal carcinomas. PMID: 17007017
  31. MAGE-A1 and NY-ESO-1 are associated with highly proliferating germ cells, whereas GAGE proteins have a more general function in germ cells unrelated to any specific developmental stage PMID: 17208940
  32. Results suggest that although MAGE-A1 does not participate directly in the drug-resistant phenotype, the expression of MAGE-A1 could be a marker for the prediction of resistance to taxan-based chemotherapies in patients with gastric cancers. PMID: 17611652
  33. These data show, for the first time, the involvement of methyl-CpG binding domain proteins in the regulation of the MAGE-A genes. PMID: 17634428
  34. Report genetic alterations of MAGE A1 in Korean colorectal cancer patients. PMID: 17704924
  35. demethylation of MAGE-A1 by Mouse embryonic stem cells PMID: 18094622
  36. Multiple simultaneous detection of MAGE-A [subtypes] more specific and sensitive than detection of single MAGE-A antigen for the diagnostic and prognostic evaluation of oral squamous cell carcinoma PMID: 18197853
  37. The protective effect of the expression of the MAGE-A1 gene against tumoral progression of neuroblastoma is confirmed. PMID: 18820946
  38. Treatment of A2780/cp70 with decitabine and belinostat results in a marked increase in expression of epigenetically silenced MLH1 and MAGE-A1 both in vitro and in vivo when compared with decitabine alone. PMID: 19259094

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Tissue Specificity
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
Database Links

HGNC: 6796

OMIM: 300016

KEGG: hsa:4100

STRING: 9606.ENSP00000349085

UniGene: Hs.72879

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*