Thanks for your inquiry. The four expression systems of NOS1 protein are futures. We have not detected the activity, but can only provide active reference information.
Recombinant Human Nitric oxide synthase, brain(NOS1) ,partial
CSB-YP015941HU >> Yeast
CSB-EP015941HU >> E.coli
CSB-BP015941HU >> Baculovirus
CSB-MP015941HU >> Mammalian cell
Tag Information: EP&BP&MP:N-terminal 10xHis-tagged and C-terminal Myc-tagged;YP:N-terminal 6xHis-tagged
Expressed sequences:
MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQE
AGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNEL
NOS1 activity reference information: https://europepmc.org/abstract/MED/8879752 Mentioned in the literatur:The cDNA transiently transfected into CHO-K1 cells expressed a protein which contained a significant level of NOS activity. You can refer to it, but we have not done this protein or detected it for the time being, which cannot guarantee 100% activity. It is suggested that you could consider ordering the eukaryotic expressed protein, which has a high possibility of activity.