Recombinant Human Pro-epidermal growth factor(EGF) ,partial

Code CSB-RP062444h
Product Type Recombinant Protein
Size US$1726
Uniprot No. P01133
Relevance EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagent of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Urogastrone
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Research Area Signal Transduction
Source E.coli
Gene Names EGF
Expression Region 977-1023
Tag Info N-terminal GST-tagged
Mol. Weight 32.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro
Involvement in disease Hypomagnesemia 4 (HOMG4)
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Expressed in kidney, salivary gland, cerebrum and prostate.
Database Links

HGNC: 3229

OMIM: 131530

KEGG: hsa:1950

STRING: 9606.ENSP00000265171

UniGene: Hs.419815

Pathway ErbB signaling pathway
HIF-1 signaling pathway
Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Ras signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

EGF Antibodies

EGF Antibodies for Homo sapiens (Human)

EGF Proteins

EGF Proteins for Homo sapiens (Human)

EGF ELISA Kit

EGF ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.