Recombinant Human Pro-neuregulin-2, membrane-bound isoform(NRG2),partial

Code CSB-YP016078HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. O14511
Relevance Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAK
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Research Area Neuroscience
Source Yeast
Gene Names NRG2
Protein Names Recommended name: Pro-neuregulin-2, membrane-bound isoform Short name= Pro-NRG2 Cleaved into the following chain: 1. Neuregulin-2 Short name= 2. NRG-2 Alternative name(s): Divergent of neuregulin-1 Short name= DON-1 Ne
Expression Region 112-405aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 34.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Subcellular Location Pro-neuregulin-2, membrane-bound isoform: Cell membrane, Single-pass type I membrane protein
Protein Families Neuregulin family
Tissue Specificity Restricted to the cerebellum in the adult.
Database Links

HGNC: 7998

OMIM: 603818

KEGG: hsa:9542

STRING: 9606.ENSP00000354910

UniGene: Hs.408515

Pathway ErbB signaling pathway

Related Products

NRG2 Antibodies

NRG2 Antibodies for Homo sapiens (Human)

NRG2 Antibodies for Human

NRG2 Proteins

NRG2 Proteins for Homo sapiens (Human)

NRG2 ELISA Kit

NRG2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.