Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Divergent of neuregulin 1; Divergent of neuregulin-1; Don 1; DON-1; Neural- and thymus-derived activator for ERBB kinases; Neuregulin 2; Neuregulin-2; NRG-2; Nrg2; NRG2_HUMAN; NTAK; Pro NRG2; Pro-NRG2
Species
Homo sapiens (Human)
Expression Region
112-405aa
Target Protein Sequence
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human NRG2 was expressed with the amino acid range of 112-405. The expected molecular weight for the NRG2 protein is calculated to be 34.8 kDa. This protein is generated in a yeast-based system. The NRG2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant NRG2 protein during the following stages.
The human pro-neuregulin-2 (NRG2) is a membrane-bound isoform of the NRG2 protein. pro-NRG2 is initially anchored to the cell membrane. Through proteolytic processing, it can be cleaved to release soluble fragments that act as ligands for ErbB receptor tyrosine kinases. Activation of ErbB receptors triggers intracellular signaling cascades that regulate cell growth, survival, and differentiation. NRG2 is expressed in various tissues, including the nervous system and the heart, suggesting its diverse functions in both neuronal and cardiac development. Research on pro-NRG2 spans neural and cardiovascular biology, exploring its contributions to cellular processes and its potential implications in diseases such as cancer and heart disorders.