Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial

In Stock
Code CSB-YP016078HU
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
NRG2
Uniprot No.
Research Area
Neuroscience
Alternative Names
Divergent of neuregulin 1; Divergent of neuregulin-1; Don 1; DON-1; Neural- and thymus-derived activator for ERBB kinases; Neuregulin 2; Neuregulin-2; NRG-2; Nrg2; NRG2_HUMAN; NTAK; Pro NRG2; Pro-NRG2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
112-405aa
Target Protein Sequence
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
34.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human NRG2 was expressed with the amino acid range of 112-405. The expected molecular weight for the NRG2 protein is calculated to be 34.8 kDa. This protein is generated in a yeast-based system. The NRG2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant NRG2 protein during the following stages.

The human pro-neuregulin-2 (NRG2) is a membrane-bound isoform of the NRG2 protein. pro-NRG2 is initially anchored to the cell membrane. Through proteolytic processing, it can be cleaved to release soluble fragments that act as ligands for ErbB receptor tyrosine kinases. Activation of ErbB receptors triggers intracellular signaling cascades that regulate cell growth, survival, and differentiation. NRG2 is expressed in various tissues, including the nervous system and the heart, suggesting its diverse functions in both neuronal and cardiac development. Research on pro-NRG2 spans neural and cardiovascular biology, exploring its contributions to cellular processes and its potential implications in diseases such as cancer and heart disorders.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.
Gene References into Functions
  1. reduced expression of NRG2 led to marginal increase in cell survival under arsenite-induced stress. PMID: 27345716
  2. examination of the effect of isoforms on angiogenesis PMID: 14722120
  3. Nrg-2-induced Acetylcholine Receptor transcription requires an N-box motif and is regulated by alternative splicing. PMID: 15961242
  4. Linkage interval for GLC1M was refined to a smaller region. The NRG2 gene was excluded as the causative gene for juvenile-onset primary open angle glaucoma. PMID: 17563728
  5. Gln43 of NRG2beta is both necessary and sufficient for NRG2 stimulation of ErbB4 coupling to IL3 independence. PMID: 17945187
  6. NRG2 was positive in almost all breast cancers studied. High expression is related to the biological aggressiveness of breast cancer. PMID: 17962208

Show More

Hide All

Subcellular Location
[Pro-neuregulin-2, membrane-bound isoform]: Cell membrane; Single-pass type I membrane protein.; [Neuregulin-2]: Secreted.
Protein Families
Neuregulin family
Tissue Specificity
Restricted to the cerebellum in the adult.
Database Links

HGNC: 7998

OMIM: 603818

KEGG: hsa:9542

STRING: 9606.ENSP00000354910

UniGene: Hs.408515

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*