Recombinant Human DNA dC->dU-editing enzyme APOBEC-3A (APOBEC3A)

In Stock
Code CSB-EP001921HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
APOBEC3A
Uniprot No.
Research Area
Signal Transduction
Alternative Names
A3A; ABC3A_HUMAN; APOBEC3A; Apolipoprotein B mRNA editing enzyme; Apolipoprotein B mRNA editing enzyme; catalytic polypeptide like 3A; ARP3; bK150C2.1; Catalytic polypeptide like 3A; Phorbolin 1; Phorbolin-1; PHRBN; Probable DNA dC >dU editing enzyme APOBEC-3A; Probable DNA dC->dU-editing enzyme APOBEC-3A
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-199aa
Target Protein Sequence
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.0kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am interested in purchasing the APOBEC3A recombinant protein (CSB-EP001921HU).I plan to use the protein in enzyme assays.
(1) Has this product been tested for enzyme activity? APOBEc3A is a cytidine deaminase enzyme.
(2) What is the location of the His-SUMO tag? N- or C-terminal? The tag is relatively large (>half the size of APOBEC3A), and it can potentially abolish the enzyme activity.
In case the product has not been tested for enzyme activity, what is the Cusabio policy regarding product return, in case we obtain the product and find that it has no activity?

A:
Thanks for your inquiry!
Regarding activity, we haven't tested the activity of this protein yet so we can't 100% guarantee that it has activity. The protein we provide is mature and full-length and purified under mild conditions, which should have activity in theory. If the customer purchased this protein and find that it has no activity, we do not accept a refund. If the customer is not at ease, we could remove the tag or provide N-terminal 6xHis-tag instead which is much smaller.
1. Tag Removal Service
If we succeed in removing the tag, we will charge for extra cost. If we fail in removing the tag, we won’t charge for any extra cost.
2. The following are the details and distributor price of N-terminal 6xHis-tagged protein.
Code: CSB-EP001921HU
Name: Recombinant Human Probable DNA dC->dU-editing enzyme APOBEC-3A(APOBEC3A)
Expression Region: 1-199aa, Full Length
Tag Info: N-terminal 6xHis-tag
Expression Sequence:

MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDT
FVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN

Q:

Please kindly consult the shipment date of csb-ep001921hu. How long will it take? And can you provide the concentration of this protein?

A:
Thanks for your inquiry.
Code: CSB-EP001921HU
Name: Recombinant Human Probable DNA dC->dU-editing enzyme APOBEC-3A(APOBEC3A)
Expression Region: 1-199aa, Full Length
Tag Info: N-terminal 6xHis-SUMO-tag
Expression Sequence:
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN
Concentration: The protein concentration of each batch won't be exactly the same but we could guarantee 0.1-2.0mg/ml concentration.
If you have special requirement for protein concentration, please communicate with us in advance.
Shipping format: The default delivery form is liquid form. If you have demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)?
With our endotoxin removal service we guarantee the endotoxin level to be less than 0.1ng/ug (1EU ug).
Both aseptic processing and endotoxin removal services are free of charge, however they must be requested when the order is placed.
Shipping condition: These products are routinely shipped on ice packs.
Purity: The minimum purity that we can guarantee is 90% as determined by SDS-PAGE.
We adopt Nickel column affinity chromatography method for protein purification, we will decide if it needs a secondary AKTA-SEC purification by the SDS-PAGE result of the initial purity above 90%.
If the initial purity SDS-PAGE result is already qualified for the QC standard (>90%), and you don’t remark any strict requirement on the purity, generally we will not conduct AKTA-SEC for secondary purification.
The final purity will be shown on the COA report.

Free Service: Endotoxin removal, Filter-sterilization, Lyophilization (Note: Lyophilization and filter-sterilization can’t be met at the same time)

Target Background

Function
DNA deaminase (cytidine deaminase) with restriction activity against viruses, foreign DNA and mobility of retrotransposons. Exhibits antiviral activity against adeno-associated virus (AAV) and human T-cell leukemia virus type 1 (HTLV-1) and may inhibit the mobility of LTR and non-LTR retrotransposons. Selectively targets single-stranded DNA and can deaminate both methylcytosine and cytosine in foreign DNA. Can induce somatic hypermutation in the nuclear and mitochondrial DNA. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
Gene References into Functions
  1. the APOBEC3A/B deletion polymorphism was not associated with risk of breast, lung, colon or prostate cancer in this Norwegian cohort PMID: 29140415
Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Cytidine and deoxycytidylate deaminase family
Tissue Specificity
Expressed in peripheral leukocytes with higher expression in CD14-positive phagocytic cells. Highly expressed in keratinocytes and in periphery blood monocytes. Also detected in non-lymphoid tissues including lung and adipose tissues. Found at high levels
Database Links

HGNC: 17343

OMIM: 607109

KEGG: hsa:100913187

STRING: 9606.ENSP00000249116

UniGene: Hs.226307

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*