Recombinant Human Proteasome subunit beta type-7 (PSMB7), partial

Code CSB-RP013454h
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PSMB7
Uniprot No.
Research Area
Immunology
Alternative Names
Macropain chain Z; Multicatalytic endopeptidase complex chain Z; Proteasome (prosome macropain) subunit beta type 7; Proteasome beta 7 subunit; Proteasome catalytic subunit 2; Proteasome subunit alpha; Proteasome subunit beta 7 ; Proteasome subunit beta type-7; Proteasome subunit Z; PSB7_HUMAN; PSMB7; PUP1; Z
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
44-275aa
Target Protein Sequence
TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
52.1kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB7 displays a trypsin-like activity.
Gene References into Functions
  1. Studied the associations of Protein Z (PROZ G79A) and Endothelin-1 (EDN1 G5665T) polymorphisms with the clinical features of sickle cell disease (SCD) in a cohort of Egyptian children with SCD. PMID: 28548215
  2. reduced protein levels in patients with rheumatoid arthritis in association with disease progression PMID: 21713324
  3. high PSMB7 expression is associated with anthracycline resistance in breast cancer. PMID: 20010949
  4. Low protein Z levels but not protein Z gene G79A polymorphism are a risk factor for ischemic stroke. PMID: 18378283
  5. A previously unreported sporadic missense mutation within exon 8 is described in a patient with very low protein Z levels. PMID: 18462727
  6. PSB7, PRDX1, and SRP9 up-regulation as candidate biomarkers of colon cancer is discovered PMID: 18549262
  7. ZPI functions like other serpins to regulate the activity of FXa but in a manner uniquely dependent on protein Z, procoagulant membranes, and pH PMID: 18768472
  8. we have identified and characterized a new phosphorylated isoform of the human 20S proteasome b7 subunit and showed its differential expression in tumor vs. normal cell lines PMID: 19645816

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Peptidase T1B family
Tissue Specificity
Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues.
Database Links

HGNC: 9544

OMIM: 604030

KEGG: hsa:5695

STRING: 9606.ENSP00000259457

UniGene: Hs.213470

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*