Recombinant Human Protein cereblon(CRBN)

Product Type Recombinant Protein
Uniprot No. Q96SW2
Abbreviation CRBN
Species Homo sapiens (Human)
Gene Names CRBN
Protein Names Recommended name: Protein cereblon
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
HGNC 30185
RGD 1310533
MGI 1913277
Function Substrate recognition component of a DCX (DDB1-CUL4-X-box) E3 protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as MEIS2. Normal degradation of key regulatory proteins is required for normal limb outgrowth and expression of the fibroblast growth factor FGF8. May play a role in memory and learning by regulating the assembly and neuronal surface expression of large-conductance calcium-activated potassium channels in brain regions involved in memory and learning via its interaction with KCNT1. Binding of pomalidomide and other thalidomide-related drugs changes the substrate specificity of the human protein, leading to decreased degradation of MEIS2 and other target proteins and increased degradation of MYC, IRF4, IKZF1 and IKZF3.
Involvement in disease Mental retardation, autosomal recessive 2A (MRT2A)
Subcellular Location Cytoplasm, Nucleus, Membrane, Peripheral membrane protein
Protein Families CRBN family
Tissue Specificity Widely expressed. Highly expressed in brain.
Database Links

HGNC: 30185

OMIM: 607417

KEGG: hsa:51185

STRING: 9606.ENSP00000231948

UniGene: Hs.18925

Product Details for Different Expression Systems

Product Name Recombinant Human Protein cereblon(CRBN),Yeast
Code CSB-YP842761HU
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGEGDQQDA AHNMGNHLPL LPAESEEEDE MEVEDQDSKE AKKPNIINFD TSLPTSHTYL GADMEEFHGR TLHDDDSCQV IPVLPQVMMI LIPGQTLPLQ LFHPQEVSMV RNLIQKDRTF AVLAYSNVQE REAQFGTTAE IYAYREEQDF GIEIVKVKAI GRQRFKVLEL RTQSDGIQQA KVQILPECVL PSTMSAVQLE SLNKCQIFPS KPVSREDQCS YKWWQKYQKR KFHCANLTSW PRWLYSLYDA ETLMDRIKKQ LREWDENLKD DSLPSNPIDF SYRVAACLPI DDVLRIQLLK IGSAIQRLRC ELDIMNKCTS LCCKQCQETE ITTKNEIFSL SLCGPMAAYV NPHGYVHETL TVYKACNLNL IGRPSTEHSW FPGYAWTVAQ CKICASHIGW KFTATKKDMS PQKFWGLTRS ALLPTIPDTE DEISPDKVIL CL
Expression Region 1-442
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Protein cereblon(CRBN),E.coli
Code CSB-EP842761HU
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGEGDQQDA AHNMGNHLPL LPAESEEEDE MEVEDQDSKE AKKPNIINFD TSLPTSHTYL GADMEEFHGR TLHDDDSCQV IPVLPQVMMI LIPGQTLPLQ LFHPQEVSMV RNLIQKDRTF AVLAYSNVQE REAQFGTTAE IYAYREEQDF GIEIVKVKAI GRQRFKVLEL RTQSDGIQQA KVQILPECVL PSTMSAVQLE SLNKCQIFPS KPVSREDQCS YKWWQKYQKR KFHCANLTSW PRWLYSLYDA ETLMDRIKKQ LREWDENLKD DSLPSNPIDF SYRVAACLPI DDVLRIQLLK IGSAIQRLRC ELDIMNKCTS LCCKQCQETE ITTKNEIFSL SLCGPMAAYV NPHGYVHETL TVYKACNLNL IGRPSTEHSW FPGYAWTVAQ CKICASHIGW KFTATKKDMS PQKFWGLTRS ALLPTIPDTE DEISPDKVIL CL
Expression Region 1-442
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Protein cereblon(CRBN),Mammalian cell
Code CSB-MP842761HU
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MAGEGDQQDA AHNMGNHLPL LPAESEEEDE MEVEDQDSKE AKKPNIINFD TSLPTSHTYL GADMEEFHGR TLHDDDSCQV IPVLPQVMMI LIPGQTLPLQ LFHPQEVSMV RNLIQKDRTF AVLAYSNVQE REAQFGTTAE IYAYREEQDF GIEIVKVKAI GRQRFKVLEL RTQSDGIQQA KVQILPECVL PSTMSAVQLE SLNKCQIFPS KPVSREDQCS YKWWQKYQKR KFHCANLTSW PRWLYSLYDA ETLMDRIKKQ LREWDENLKD DSLPSNPIDF SYRVAACLPI DDVLRIQLLK IGSAIQRLRC ELDIMNKCTS LCCKQCQETE ITTKNEIFSL SLCGPMAAYV NPHGYVHETL TVYKACNLNL IGRPSTEHSW FPGYAWTVAQ CKICASHIGW KFTATKKDMS PQKFWGLTRS ALLPTIPDTE DEISPDKVIL CL
Expression Region 1-442
Protein Description full length protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

Q&A
Q:

Can you please provide the following information regarding your product Recombinant Human Protein cereblon (CRBN) CSB-MP842761HU:
Is this recombinant protein from Magnetospirillum gryphiswaldense cereblon isoform 4 with thalidomide bound to the pocket formed by three invariant tryptophan residues?
Please let me know if you have any additional questions.

A:
Very nice to receive your inquiry.
Recombinant Human Protein cereblon(CRBN)
CSB-MP842761HU >> Mammalian cell
Expression Region: 1-442aa; Full length.
Tag information: Tag type will be determined during the manufacturing process.
The expected tag is C-terminal 6xHis-tagged.
Sequence:

MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL


Recombinant Human Protein cereblon(CRBN)
CSB-CF842761HU N-terminal 6xHis-tagged
CSB-CF842761HUc7 C-terminal 6xHis-tagged
CSB-CF842761HUa6 N-terminal 6xHis-B2M-tagged
Expression Region: 1-442aa; Full length.
Sequence:

MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL


The reference information of this protein: http://www.uniprot.org/uniprot/Q96SW2
What we provide is the Isoform 1, it contains the CULT Domain.The CULT domain binds thalidomide and related drugs…
But we are not sure about the binding form, we can't find related information or data. Maybe you can check more details in the above link.
Q:

Please can you provide information for all available sizes?
I am particularly anxious to know the tag for the baculovirus expressed protein. On a previous COA it is listed as N terminal 6 His tag, is this information still correct?
We would also like to know if you have received feedback from any of your customers about activity of this protein?
In addition I am looking for human DDB1 protein.
I found the following catalog number however I did not find the sequence, is this full length or partial? Have you received any feedback about activity of this protein? Do you have any other options that might be of my interest?
CSB-EP618079HU; CSB-YP618079HU; CSB-BP618079HU; CSB-MP618079HU Recombinant Human DNA damage-binding protein 1 (DDB1), partial
Please can you provide information for all available sizes of all available expression hosts?

A:
Thanks for your inquiry.
Recombinant Human Protein cereblon(CRBN)
CSB-EP842761HU >> E.coli
You can view the full information of this product on this page.
Regarding the tag of CSB-BP842761HU, yes, the tag of the previous Lot is N-terminal 6xHis-tagged, and the tag information on the COA is surely correct.But later we have optimized a much better protein with C-terminal 9xHis-tagged, so this BP protein has been updated with C-terminal 9xHis-tagged.
If you still need the same protein as previous Lot with N-terminal 6xHis-tagged, we can also provide, please remark your requirement when placing the order.
We previously received feedback like this "I was apparently very happy with the previous order of CSB-BP842761HU, and will be placing another order soon. I would like to know if the same lead time applies to this new order? Since I recently purchase this product,I thought it may be possible that you have some of the material still made that might speed up the production time. Could you advise on the lead time of a new order?", the customer didn't feedback about the activity, but we guess it should have great potential to be active.
2.human DDB1 protein.
Recombinant Human DNA damage-binding protein 1(DDB1) ,partial
CSB-YP618079HU >> Yeast
CSB-EP618079HU >> E.coli
CSB-BP618079HU >> Baculovirus
CSB-MP618079HU >> Mammalian cell
Expression Region:391-709aa; Partial.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

RNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQK

Customer Reviews

Related Products

CRBN Antibodies

CRBN Antibodies for Homo sapiens (Human)

CRBN Antibodies for Human

CRBN Proteins

CRBN Proteins for Homo sapiens (Human)

CRBN Proteins for Homo sapiens(Human)

CRBN ELISA Kit

CRBN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.