Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Code CSB-EP021173HU
Size Pls inquire other sizes
Source E.coli
Code CSB-EP021173HU-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Code CSB-MP021173HU
Size Pls inquire other sizes
Source Mammalian cell

Product Details

Purity >85% (SDS-PAGE)
Target Names SFTPB
Uniprot No. P07988
Species Homo sapiens (Human)
Expression Region 201-279
Target Protein Sequence FPIPLPYCWL CRALIKRIQA MIPKGALAVA VAQVCRVVPL VAGGICQCLA ERYSVILLDT LLGRMLPQLV CRLVLRCSM
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Q&A and Customer Reviews

 Q&A
Q:

For YP – what do you mean by no tag? You have YP in no tag?
eg:Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
CSB-YP021173HU >> Yeast 25-35 working days
Expression Region: 201-279aa; Mature full length protein.
Tag information:NO-tagged.
Sequence:

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

A:
Thanks for your inquiry. Yes, we have successfully expressed this untagged YP protein using the untagged vector , we can send you the previous COA for your reference.
Q:

Could you please then advise on how the protein is purified. Since it does not have any tag?

A:
Thanks for your inquiry. Generally, the purification methods for untagged protein are hydrophobic chromatography, ion exchange, molecular sieves.
For fusion protein with tag, the general purification method is affinity chromatography.
 Customer Reviews

Target Data

Function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Involvement in disease Pulmonary surfactant metabolism dysfunction 1 (SMDP1); Respiratory distress syndrome in premature infants (RDS)
Subcellular Location Secreted, extracellular space, surface film
Database Links

HGNC: 10801

OMIM: 178640

KEGG: hsa:6439

STRING: 9606.ENSP00000377409

UniGene: Hs.512690

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.