Recombinant Human Pulmonary surfactant-associated protein D(SFTPD)

Code CSB-YP021175HU
Size US$1593
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP021175HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP021175HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SFTPD
Uniprot No. P35247
Research Area Cancer
Alternative Names COLEC 7; COLEC7; Collectin-7; Collectin7; Lung surfactant protein D; PSP D; PSP-D; PSP-D Surfactant protein D; PSPD; Pulmonary surfactant apoprotein; Pulmonary surfactant associated protein D; Pulmonary surfactant associated protein PSP-D; Pulmonary surfactant-associated protein D; SFTP 4; SFTP4; SFTPD; SFTPD_HUMAN; SP D; SP-D; Surfactant associated protein pulmonary 4; Surfactant protein D; Surfactant pulmonary associated protein D
Species Homo sapiens (Human)
Source Yeast
Expression Region 21–375aa
Target Protein Sequence AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 35.2kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
Gene References into Functions
  1. these findings indicate that the membrane-type surfactant protein D serve as an effective therapeutic strategy for inhibiting macrophage-mediated xenograft rejection in xenotransplantation PMID: 29425774
  2. Assays that can separate SP-D proteolytic breakdown products or modified forms from naturally occurring SP-D trimers may result in optimal disease markers for pulmonary inflammatory diseases PMID: 28960651
  3. the SPA and SPD levels in EBC were correlated with lung function, which contributed to COPD diagnosis. PMID: 28791362
  4. Studied predictive value of surfactant protein D (SP-D) in lung cancer patients with interstitial lung disease induced by anticancer agents (ILD-AA). Results suggest that SP-D level change was a risk factor for mortality in patients with ILD-AA, and that SP-D might be a predictive prognostic biomarker of ILD-AA. PMID: 28464801
  5. SP-D also delays FasL-induced death of primary human T cells. SP-D delaying the progression of the extrinsic pathway of apoptosis could have important implications in regulating immune cell homeostasis at mucosal surfaces PMID: 28168327
  6. Trimeric SP-D wildtype recognized larger LPS inner core oligosaccharides with slightly enhanced affinity than smaller compounds suggesting the involvement of stabilizing secondary interactions. PMID: 27350640
  7. rs2819096 in the surfactant protein D (SFTPD) gene was associated with a higher risk of COPD GOLD III + IV. PMID: 27078193
  8. SP-D increases the formation of nuclear and membrane blebs. Inhibition of caspase-8 confirms the effect of SP-D is unique to the caspase-8 pathway. PMID: 29107869
  9. Findings indicate serum pulmonary surfactant protein D (SP-D, SFTPD) level as a potential marker to estimate the efficacy of epidermal growth factor receptor (EGFR)-tyrosine kinase inhibitor (TKIs). PMID: 28745320
  10. Patients with SP-D 11Thr/Thr genotype were more susceptible to acute kidney injury (AKI). Compared with healthy controls, serum SP-D levels at day 1, 3 and 7 were significantly elevated in AKI patients. PMID: 28212617
  11. This review intends to provide a current overview of the genetics, structure and extra-pulmonary functions of the surfactant collectin proteins. PMID: 28351530
  12. Meta-analysis found that serum SP-A/D detection might be useful for differential diagnosis and prediction of survival in patients with idiopathic pulmonary fibrosis. PMID: 28591049
  13. The findings suggest that SP-D inhibits LPS-stimulated production of interleukin-12p40 via the SIRPalpha/ROCK/ERK signaling pathway. PMID: 28641719
  14. Efficient lipopolysaccharide recognition by SP-D requires multiple binding interactions utilizing the three major ligand-binding determinants in the SP-D binding pocket, with Ca-dependent binding of inner-core heptose accompanied by interaction of anhydro-Kdo (4,7-anhydro-3-deoxy-d-manno-oct-2-ulosonic acid) with Arg343 and Asp325. PMID: 26953329
  15. SP-D levels in bronchoalveolar lavage samples were significantly lower in severe asthma compared with healthy controls and mild asthma. Serum SP-D was significantly increased in severe asthma compared with healthy controls and mild asthma. PMID: 26836907
  16. Surfactant protein D levels differed among idiopathic pulmonary fibrosis, pulmonary sarcoidosis and chronic pulmonary obstructive disease. PMID: 27758987
  17. Elevated levels of SP-D are Associated with Idiopathic Pulmonary Fibrosis. PMID: 27293304
  18. Data do not support that pSP-D levels influence or reflect the development of subclinical atherosclerosis. However, the data support that SP-D plays a role in the etiology of atherosclerotic disease development. PMID: 26748346
  19. Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy. PMID: 26603976
  20. Serum SP-D may serve as a convenient medium to distinguish lung infection caused by M. pneumoniae. PMID: 26617840
  21. findings shed new light on the discovery and/or development of a useful biomarker based on glycosylation changes for diagnosing COPD. PMID: 26206179
  22. Quantitative real-time PCR experiments disclosed significantly increased leukocyte NOS2 and SFTPD mRNA levels in hyperglycemic gestational diabetes mellitus patients (P < 0.05). PMID: 26568332
  23. Serum SP-D was not significantly different between patients with connective tissue disease-interstitial lung disease, chronic fibrosing interstitial pneumonia patients and healthy controls. PMID: 26424433
  24. Letter: report higher serum SP-D levels in bird-related hypersensitivity pneumonitis during winter. PMID: 25591150
  25. The SP-D level showed positive correlations with carotid IMT and coronary artery calcification in patients on long-term hemodialysis. PMID: 27012038
  26. SP-D is expressed differently in airways of asthmatics relative to that of non-asthmatics. PMID: 25848896
  27. Sputum and bronchoalveolar lavage fluid SFTPD were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls. PMID: 25728058
  28. We demonstrated for the first time in a Chinese population cohort that genetic polymorphisms of SP-D are not only associated with risk of COPD development, but also related to disease manifestation and that they predict outcomes. PMID: 25376584
  29. In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function. PMID: 25851191
  30. In Sjogren's syndrome, high SP-D levels were found in patients with severe glandular involvement, hypergammaglobulinemia, leukopenia, extraglandular manifestations, and positive anti-Ro/La antibodies. PMID: 25362659
  31. Results revealed that higher circulating levels of SP-D are associated with higher mortality risk in critically ill A/H1N1 patients. PMID: 25537934
  32. In idiopathic pleuroparenchymal fibroelastosis SP-D was elevated, while KL-6 was within a normal range. PMID: 24880792
  33. These data suggest that SP-D reduces EGF binding to EGFR through the interaction between the carbohydrate recognition domain of SP-D and N-glycans of EGFR, and downregulates EGF signaling. PMID: 24608429
  34. the multi-faceted role of human SP-D against HIV-1 PMID: 25036364
  35. SFTPD polymorphism is associated with the risk of respiratory outcomes; it may be an essential factor affecting pulmonary adaptation in premature infants PMID: 25015576
  36. Results suggest that Smokers who are carriers of the SFTPD AG and AA polymorphic genotypes may be at a higher risk of developing Chronic obstructive pulmonary disease when compared with wild-type GG genotype carriers. PMID: 24504887
  37. Both mRNA and protein levels of gp340 were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls. PMID: 24121782
  38. In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions. PMID: 24960334
  39. murine expression of human polymorphic variants does not significantly influence the severity of allergic airway inflammation PMID: 24712849
  40. Genetic disposition for low surfactant protein-D was not associated with rheumatoid arthritis but with erosive rheumatoid arthritis by interaction with smoking. PMID: 24264011
  41. SP-D levels were significantly higher in the sub-massive pulmonary embolism group overall. PMID: 25291941
  42. a novel pathway for the immunomodulatory functions of SP-D mediated via binding of its collagenous domains to LAIR-1. PMID: 24585933
  43. Human surfactant protein D alters oxidative stress and HMGA1 expression to induce p53 apoptotic pathway in eosinophil leukemic cell line. PMID: 24391984
  44. Surfactant protein D substitutions at the 325 and 343 positions (D325A+R343V) exhibit markedly increased antiviral activity for seasonal strains of influenza A virus. PMID: 24705721
  45. SFTPD single-nucleotide polymorphisms, rs1923536 and rs721917, and haplotypes, including these single-nucleotide polymorphisms or rs2243539, were inversely associated with expiratory lung function in interaction with smoking. PMID: 24610936
  46. Increases in serum KL-6 and SP-D levels during the first 4 weeks after starting therapy, but not their levels at any one time point, predict poor prognosis in patients with polymyositis/dermatomyositis. PMID: 22983659
  47. serum SP-D, but not SP-A, levels were significantly higher in the German than in the Japanese cohort PMID: 24400879
  48. Lower oligomeric form of surfactant protein D is associated with cystic fibrosis. PMID: 24120837
  49. Lung permeability biomakers [surfactant protein D (SP-D) and Clara cell secretory protein (CC16) in plasma] and forced expiratory volumes and flow were measured in swimmers in indoor swimming pool waters treated with different disinfection methods. PMID: 23874631
  50. In patients with systemic sclerosis-related interstitial lung disease, surfactant protein D was correlated with forced vital capacity. It was not a longterm prognostic indicator. PMID: 23588945
  51. we identified no novel surfactant protein D gene (SFTPD) coding or splice region variants in 73 unrelated children with diffuse lung disease PMID: 23932215
  52. Data suggest that human surfactant protein D not only binds to glycan chains on HA (hemagglutinin, human influenza A virus, strain H3N2) but also blocks the sialic acid receptor binding site upon binding to the glycan chains on HA. PMID: 24224757
  53. Donor surfactant protein D polymorphisms are associated with chronic lung allograft dysfunction. PMID: 23841811
  54. SP-D levels are associated with 1-year prognosis in patients with chronic kidney disease. PMID: 23314596
  55. SP-D modulates the inflammatory response and helps to maintain a balance between effective neutralization/killing of IAV, and protection against alveolar damage resulting from IAV-induced excessive inflammatory responses PMID: 23391661
  56. SP-D gene polymorphisms are associated with insulin resistance and T2D PMID: 23577114
  57. SP-D may be important for early detection of interstitial pneumonitis in pegylated interferon treated hepatitis C patients. PMID: 23435141
  58. Review discussing associations between COPD and lung specific surfactant protein D (SP-D) single nucleotide polymorphisms, as well as how COPD has been associated with higher levels of serum SP-D.[review] PMID: 23244171
  59. Unlike collectins or human neutrophil defensins (HNPs), LL-37 did not induce viral aggregation. PMID: 23052388
  60. Cleavage of SP-D by MMP-9 using levels of protein similar to that observed in patients with chronic lung disease suggests in vivo relevance for this cleavage event. PMID: 22860023
  61. A Genome wide association study for COPD biomarkers on subjects with COPD identified single nucleotide polymorphisms with surfactant protein D in expressed sputum. PMID: 23144326
  62. SP-D can protect the bladder urothelium against UPEC infection and suggest a possible function of SP-D in urinary tract. PMID: 23012359
  63. The SFTPD single nucleotide polymorphism, rs721917, was associated with emphysema, interstitial pneumonia, and lung cancer. Haplotypes associated with emphysema and lung cancer differed from that associated with interstitial pneumonia. PMID: 22509983
  64. Polymorphism at rs721917 is associated with reduced serum SP-D levels and risk of Chronic Obstructive Pulmonary Disease. PMID: 22846212
  65. SFTPD polymorphism provide evidence in the development of bronhopulmonary dysplasia and respiratory distress syndrome in premature infants. PMID: 21960125
  66. Surfactant protein D (Sp-D) binds to membrane-proximal domain (D3) of signal regulatory protein alpha (SIRPalpha), a site distant from binding domain of CD47, while also binding to analogous region on signal regulatory protein beta (SIRPbeta). PMID: 22511785
  67. Results suggest that the fetal surfactant protein D Met31Thr polymorphism plays a significant role in genetic predisposition to spontaneous preterm birth. PMID: 22289856
  68. This suggests a protective effect of SFTPD against COPD and emphysema. PMID: 21934714
  69. Pulmonary surfactant protein D exhibited diurnal variation in healthy controls and in patients with early or late rheumatoid arthritis, with peak values at 10 AM and nadir in the evening. PMID: 20512337
  70. Data sshow that variants in SFTPD, CD46 and IL1R1 are associated with IPD in both EA and AA. PMID: 21858107
  71. High serum surfactant protein-D is associated with lung cancer. PMID: 21828236
  72. genetic association of 2 nonsynonymous SP-D SNPs rs721917 and rs2243639 in inflammatory bowel disease (IBD) cases and controls; results suggest differential allelic expression may affect penetrance of the SNP rs721917 disease-susceptibility allele in IBD PMID: 21790524
  73. there is an association of risk for severe acute respiratory syncytial infection in individuals who present the allele Thr160 in surfactant protein D PMID: 21601013
  74. surfactant protein A and surfactant protein D play critical roles in host defense against Mycobacterium avium. PMID: 21821801
  75. Reduction of surfactant protein D in H5N1 influenza may play important roles in the pathogenesis of the disease. PMID: 21678446
  76. SNPs unrelated to susceptibility to inflammatory bowel disease in German population PMID: 21560203
  77. The levels of intracellular reactive oxygen species and lipid peroxidation in A549 cells increased with increasing exposure to NiO nanoparticles, and increases in gene expressions of HO-1 and SP-D were observed PMID: 21233593
  78. Circulating surfactant protein D concentrations are higher in intrauterine growth-restricted fetuses than in pulmonary diseases inappropriate for gestational age and intrauterine growth-restricted pregnancies. PMID: 20360592
  79. Introduction of N-linked glycans in the lectin domain of surfactant protein D: impact on interactions with influenza A viruses. PMID: 21489996
  80. surfactant protein D interacts with myeloperoxidase on the surface of late apoptotic neutrophils PMID: 21204009
  81. Pulmonary and serum SP-D levels are stable markers influenced by smoking and related to airflow obstruction and disease state in chronic pulmonary obstructive disease. PMID: 21396106
  82. Mean serum SP-D concentrations in patients with RSV bronchiolitis were higher than those in the control group. Mean serum SP-D concentrations were higher in the in Stage C than in Stages A or B patients, and higher in Stage B than in Stage A patients. PMID: 21171185
  83. Polymorphisms in surfactant protein-D are associated with chronic obstructive pulmonary disease PMID: 20448057
  84. Serum SP-D (Surfactant protein D) in Cystic Fibrosis patients was increased in parallel with leukocyte count and with reduced FEV-1 (forced expiratory volume 1) PMID: 20457545
  85. An extended binding site for influenza A virus; calcium-dependent antiviral activity involves residues flanking the primary carbohydrate binding site as well as more remote residues displayed on the carbohydrate recognition domain surface. PMID: 20601494
  86. Letter: serum SP-D cannot be used as a biomarker predictive for bronchiolitis obliterans after lung transplantation. PMID: 20683434
  87. Surfactant protein-D showed to be a significant predictor of prognosis, even when corrected for age, sex, smoking, and lung function. PMID: 20560296
  88. Findings suggest that lung innate immunity, as inferred from circulating SP-D concentrations, is at the cross-roads of inflammation, obesity, and insulin resistance. PMID: 20086254
  89. inhibition of Der p-induced activation of macrophages and monocyte-derived dendritic cells by SP-D is mediated through suppression of the CD14/TLR signalling pathway and maintenance of DC-SIGN expression. PMID: 20205699
  90. the time-dependent variation in serum SP-D throughout a period of 6 months was characterized. PMID: 19540617
  91. analysis of myeloperoxidase-dependent inactivation of surfactant protein D in vitro and in vivo PMID: 20228064
  92. SP-D utilizes a novel mechanism in which the collectin interacts with protease inhibitor A2M to decrease its degradation and to concurrently increase its innate immune function. PMID: 20207732
  93. SP-A and SP-D bound to L. pneumophila and its lipopolysaccharide (LPS) and inhibited the bacterial growth in a Ca(2+)-dependent manner PMID: 20056602
  94. serum SP-D levels are increased in patients during chronic obstructive pulmonary disease (COPD) exacerbations and may be a potential diagnostic biomarker for COPD exacerbations. PMID: 20075511
  95. The 343 position is critical in defining the binding pattern of SP-D proteins to Mycobacterium tuberculosis and its mannosylated cell envelope components. PMID: 19684355
  96. These findings suggest that low surfactant protein-D, unrelated to conventional disease indicators, represents an aspect of systemic lupus erythematosus etiopathogenesis. PMID: 19833760
  97. SP-D (surfactant protein D) may therefore play a significant role in the innate immune response to H. pylori infection PMID: 11854236
  98. Surfactant protein D gene regulation. Interactions among the conserved CCAAT/enhancer-binding protein elements PMID: 11912209
  99. binds Mycoplasma pneumoniae by high affinity interactions with lipids PMID: 11916969
  100. Surfactant protein D gene polymorphism associated with severe respiratory syncytial virus infection. PMID: 12032263

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, surface film
Protein Families SFTPD family
Tissue Specificity Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes).
Database Links

HGNC: 10803

OMIM: 178635

KEGG: hsa:6441

STRING: 9606.ENSP00000361366

UniGene: Hs.253495

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1