Recombinant Human Pulmonary surfactant-associated protein D(SFTPD)

Code CSB-YP021175HU
Product Type Recombinant Protein
Size US$2474
Uniprot No. P35247
Relevance Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the Extracellular domain reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP021175HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP021175HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.
Storage Buffer Tris-based buffer,50% glycerol
Alias Collectin-7 Lung surfactant protein D
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIF
Research Area Cancer
Source Yeast
Gene Names SFTPD
Protein Names Recommended name: Pulmonary surfactant-associated protein D Short name= PSP-D Short name= SP-D Alternative name(s): Collectin-7 Lung surfactant protein D
Expression Region 21–375aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 35.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
Subcellular Location Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, surface film
Protein Families SFTPD family
Tissue Specificity Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes).
Database Links

HGNC: 10803

OMIM: 178635

KEGG: hsa:6441

STRING: 9606.ENSP00000361366

UniGene: Hs.253495

Related Products

SFTPD Antibodies

SFTPD Antibodies for Homo sapiens (Human)

SFTPD Proteins

SFTPD Proteins for Homo sapiens (Human)

SFTPD ELISA Kit

SFTPD ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.