Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial

Code CSB-YP623780HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP623780HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PLA2R1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP623780HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PLA2R1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PLA2R1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; CLEC13C ; M type receptor ; M-type receptor; Phospholipase A2 receptor 1 ; PLA2 R ; PLA2-R; PLA2G1R ; PLA2IR ; PLA2R; PLA2R_HUMAN; PLA2R1; Soluble PLA2-R; Soluble PLA2R; Soluble secretory phospholipase A2 receptor
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
395-530aa
Target Protein Sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Dive into cardiovascular research with our high-quality Recombinant Human PLA2R1 protein. The secretory phospholipase A2 receptor (PLA2R1) is a type I transmembrane glycoprotein, which plays a crucial role in modulating the actions of secretory phospholipase A2 (sPLA2) enzymes, involved in lipid metabolism and inflammatory responses. This makes PLA2R1 an important target in understanding the complex mechanisms underlying cardiovascular health and disease.

Our Recombinant Human PLA2R1 protein is expressed in yeast, ensuring optimal protein folding and glycosylation. The partial protein (395-530aa) retains its native structure and functionality, while the N-terminal 6xHis-tag allows for efficient purification and detection. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human PLA2R1 protein delivers reliable results for your cardiovascular research projects. The protein is available in both liquid and lyophilized powder forms, providing you with flexibility and convenience in your experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phospholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B. In podocytes, binding of sPLA2-IB/PLA2G1B can regulate podocyte survival and glomerular homeostasis.
Gene References into Functions
  1. Compared with non-PLA2R-associated IMN patients in our cohort, PLA2R-associated IMN patients presented with more severe proteinuria and lower remission rates after treatment, with no distinct histological differences. PMID: 30032157
  2. Suggest strong genetic association between nonsynonymous SNP rs35771982 (p.His300Asp) within PLA2R1 and idiopathic membranous nephropathy. PMID: 28849274
  3. We propose a revised clinical workup flow for patients with MN that recommends assessment of kidney biopsy for PLA2R1 and THSD7A antigen expression, screening for circulating anti-podocytes antibodies, and assessment for secondary causes, especially cancer, in patients with THSD7A antibodies PMID: 29511687
  4. Five SNPs around the PLA2R1 gene were significantly associated with idiopathic membranous nephropathy. PMID: 27934873
  5. Several risk alleles related to the PLA2R1 gene and within the HLA loci have been identified, whereas epitope spreading of PLA2R may predict treatment response. More recently, thrombospondin type 1 domain-containing 7A (THSD7A) antibodies have been discovered in primary membranous nephropathy . PMID: 28904948
  6. PLA2R may play a role in some adolescent and preteen idiopathic membranous nephropathy patients but may be less frequently associated with idiopathic membranous nephropathy during childhood PMID: 27921164
  7. Anti-M-type phospholipase A2 receptor (anti-PLA2R) and anti-THSD7A (thrombospondin type-1 domain-containing 7A) were detected only in membranous neurophathy (MN) patient sera and not in controls. PMID: 27634909
  8. The frameshift mutation detected in the current study would result in premature stops of amino acid synthesis in PLA2R1 and SRPK1 proteins and hence resembles a typical inactivating mutation. PMID: 28212809
  9. Single-nucleotide polymorphism in PLA2R1 gene is associated with primary membranous nephropathy. PMID: 26673907
  10. blocking the ERRalpha-controlled mitochondrial program largely inhibits the PLA2R1-induced tumor-suppressive response. Together, our data document ERRalpha and its mitochondrial program as downstream effectors of the PLA2R1-JAK2 pathway leading to oncosuppression. PMID: 27041564
  11. Assessment of PLA2R autoimmunity is essential for patient management. Combination of PLA2R-Ab and PLA2R-Ag increases diagnosis sensitivity. PLA2R-Ab titer is a biomarker of disease severity at initial assessment, and the kinetics of the antibody are significantly correlated to disease evolution. PMID: 28257452
  12. analysis of Japanese patients reveals that anti-PLA2R antibodies are present in idiopathic membranous nephropathy but not in secondary membranous nephropathy PMID: 27355365
  13. Retrospective study to compare the value of serum anti-PLA2R antibody and glomerular PLA2R deposition in reflecting disease activity and renal function in Chinese patients with membranous nephropathy; serum anti-PLA2R antibody is more closely correlated with disease activity and renal function than glomerular PLA2R deposition. PMID: 28614271
  14. PLA2R1 is increased in the airway epithelium in asthma, and serves as a regulator of airway hyperresponsiveness, airway permeability, antigen sensitization, and airway inflammation. PMID: 27448109
  15. circulating anti-PLA2R antibodies are specific for primary membranous nephropathy. PMID: 26830547
  16. PLA2R gene polymorphism is Associated with Increased Intima-Media Thickness of the Carotid Artery. PMID: 27025682
  17. Report both serum and kidney levels of PLA2R1 autoantibody in idiopathic membranous nephropathy. PMID: 26369693
  18. Pre-transplant phospholipase A2 receptor autoantibody concentration is associated with clinically significant recurrence of membranous nephropathy post-kidney transplantation. PMID: 26854647
  19. genetic polymorphism is associated with systemic lupus erythematosus and lupus nephritis in a Chinese patients PMID: 26645973
  20. Accordingly, PLA2R ABs assay seems to be promising tool not only to diagnose MN but also to predict the course of the disease and could open the way to personalize therapy. [review] PMID: 26576418
  21. PLA2R1 expression in breast cancer cells is controlled by DNA methylation and histone modifications PMID: 26672991
  22. Assessments of both serum PLA2R antibodies and PLA2R antigen in glomeruli were more sensitive for the diagnosis of PLA2R-related membranous nephropathy PMID: 25492250
  23. Data indicate that enhanced granular expression of phospholipase A2 receptor (PLA2R) and thrombospondin type-1 domain-containing 7A (THSD7A) was detected in 9.1% and 52.7%, respectively, of the patients with idiopathic membranous nephropathy (MN). PMID: 26393352
  24. Anti-PLA2R antibodies were found in Japanese patients with idiopathic membranous nephropathy; however, the prevalence was lower than that of any other Asian country. PMID: 25412738
  25. Suggest that PLA2R has a contributory role in the pathogenesis of paediatric idiopathic membranous nephropathy. PMID: 26194981
  26. Renal biopsy PLA2R positivity was common in idiopathic membranous nephropathy (MN) and HBV-MN but rare in lupus-associated MN, and it was closely associated with serum PLA2R-Ab production. PMID: 26087695
  27. Case Report: PLA2R positive membranous nephropathy in kidney transplant recipient with both IgA nephropathy and HCV infection long after kidney transplant from identical twin. PMID: 26031599
  28. The detection and measurement of PLA2R-AB in idiopathic membranous nephropathy patients may be important tool in monitoring of the disease and efficacy of the treatment. PMID: 25953939
  29. serological anti-PLA2R testing has diagnostic value for differentiating iMN from sMN, but it must be interpreted in context with patient clinical characteristics (degree of proteinuria, immunosuppressive treatment, time of detection). PMID: 25740009
  30. Demonstrate pretransplantation circulating anti-PLA2R antibodies in a cohort of renal transplant recipients who prospectively developed recurrent disease. PMID: 25675198
  31. The sPLA2 IB-PLA2R interaction stimulated podocyte apoptosis through activating ERK1/2 and cPLA2alpha and through increasing the podocyte AA content PMID: 25335547
  32. Studies indicate that phospholipase A2 receptor 1 (PLA2R1) may act as a clearance or signaling receptor for secreted phospholipase A2 (sPLA2s). PMID: 25230085
  33. An important role of PLA2R1 in controlling cancer cell death by influencing mitochondrial biology. PMID: 23994771
  34. Data show there was strong epistasis between HLA-DQA1 single nucleotide polymorphism rs2187668 and the phospholipase A2 receptor 1 (PLA2R1) variant rs35771982. PMID: 25187357
  35. Study showed that CTLD1-2 as well as the FNII domain of PLA2R were responsible for binding to collagen I and collagen-dependent migration in both mouse and human PLA2R. PMID: 25724334
  36. Data show loss of VHL, stabilization of HIF-2alpha and increased c-MYC activity, binding and transcriptional repression, through induction of PLA2R1 DNA methylation closed to PLA2R1 transcriptional start site, results in decreased PLA2R1 transcription. PMID: 24657971
  37. 15 of 154 patients with idiopathic membranous nephropathy had circulating autoantibodies to THSD7A but not to PLA2R1, a finding that suggests a distinct subgroup of patients with this condition. PMID: 25394321
  38. This review compiles recent data demonstrating an unexpected tumor suppressive role of PLA2R1 and outlines the future work needed to improve our knowledge of the functions of this gene in cancer.[review] PMID: 24667060
  39. Suggest HLA-DQA1 and PLA2R1 polymorphisms can predict idiopathic membranous nephropathy response to immunosuppressors and disease progression. PMID: 24262501
  40. PLA2R1 plays a role in cancer as a tumor gene suppressor and is the major target antigen of auto-immune antibodies involved in idiopathic membranous nephropathy, a severe human kidney disease.[review] PMID: 24939538
  41. We conclude that a decrease in PLA2R antibody level is associated with a decrease of proteinuria in patients with primary membranous nephropathy. PMID: 24610926
  42. PLA2R staining sensitivity is much lower in the pediatric than the adult primary membranous glomerulopathy population, suggesting a more diverse and currently incompletely described set of etiologies for this disease in this group. PMID: 23903693
  43. anti-PLA2R in serum of patients with idiopathic membranous nephropathy was confirmed as a reliable diagnostic marker. PMID: 24779214
  44. The CC genotype and C allele at rs35771982 in PLA2R gene are associated with susceptibility to IMN in Chinese Hans. PMID: 24327152
  45. We present the largest case series to date examining PLA2R1 involvement in membranous glomerulopathy PMID: 23196797
  46. High levels of PLA2R antibodies are linked with active disease and a higher risk of declining renal function during follow-up in idiopathic membranous nephropathy. PMID: 23364522
  47. the interaction between PLA2R1 and HLA-DQA1 risk alleles associates with the development of idiopathic membranous nephropathy in the Chinese population. PMID: 23813219
  48. rare variants in the coding sequence of PLA2R1, including splice sites, are unlikely to explain the pathogenesis of idiopathic membranous nephropathy. PMID: 23431073
  49. Data show that the genotyping technique of single nucleotide polymorphisms (SNPs) rs2187668 and rs4664308 within HLA-DQA1 and PLA2R1 is valuable for assessing susceptibility to idiopathic membranous nephropathy (IMN). PMID: 23194743
  50. Increased staining for PLA2R in glomeruli of renal biopsies tightly correlates with the presence of PLA2R autoantibodies in the serum and this may help discriminate between primary and secondary membranous nephropathy. PMID: 22673885

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Soluble secretory phospholipase A2 receptor]: Secreted.; [Isoform 2]: Secreted.
Tissue Specificity
Expressed in podocytes (at protein level). Present in lung macrophage (at protein level). Highly expressed in kidney. Also expressed in pancreas, amnion, choriodecidua and placenta. Isoform 2 is expressed at much lower level.
Database Links

HGNC: 9042

OMIM: 604939

KEGG: hsa:22925

STRING: 9606.ENSP00000283243

UniGene: Hs.410477

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*