Recombinant Human Signal transducer and activator of transcription 5B(STAT5B)

Product Type Recombinant Protein
Uniprot No. P51692
Species Homo sapiens (Human)
Gene Names STAT5B
Protein Names Recommended name: Signal transducer and activator of transcription 5B
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Target Details This protein is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.
HGNC 11367
RGD 3774
MGI 103035
Function Carries out a dual function
Involvement in disease Growth hormone insensitivity with immunodeficiency (GHII)
Subcellular Location Cytoplasm, Nucleus
Protein Families Transcription factor STAT family
Database Links

HGNC: 11367

OMIM: 245590

KEGG: hsa:6777

STRING: 9606.ENSP00000293328

UniGene: Hs.595276

Pathway Chemokine signaling pathway
ErbB signaling pathway
Jak-STAT signaling pathway
Necroptosis
Th1 and Th2 cell differentiation
Th17 cell differentiation
AGE-RAGE signaling pathway in diabetic complications

Product Details for Different Expression Systems

Product Name Recombinant Human Signal transducer and activator of transcription 5B(STAT5B),Yeast
Code CSB-YP022815HU
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence WSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFS DSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVYSKYYTPVPCE SATAKAVDGYVKPQIKQVVPEFVNASADAGG GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFD LEDTMDVARRVEELLGRPMDSQ WIPHAQS
Expression Region 545-787
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Signal transducer and activator of transcription 5B(STAT5B),E.coli
Code CSB-EP022815HU
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence WSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFS DSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVYSKYYTPVPCE SATAKAVDGYVKPQIKQVVPEFVNASADAGG GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFD LEDTMDVARRVEELLGRPMDSQ WIPHAQS
Expression Region 545-787
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Signal transducer and activator of transcription 5B(STAT5B),Baculovirus
Code CSB-BP022815HU
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence WSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFS DSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVYSKYYTPVPCE SATAKAVDGYVKPQIKQVVPEFVNASADAGG GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFD LEDTMDVARRVEELLGRPMDSQ WIPHAQS
Expression Region 545-787
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human Signal transducer and activator of transcription 5B(STAT5B),Mammalian cell
Code CSB-MP022815HU
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence WSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFS DSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL GDLNYLIYVFPDRPKDEVYSKYYTPVPCE SATAKAVDGYVKPQIKQVVPEFVNASADAGG GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFD LEDTMDVARRVEELLGRPMDSQ WIPHAQS
Expression Region 545-787
Protein Description Full Length of Mature Protein
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

STAT5B Antibodies

STAT5B Antibodies for Homo sapiens (Human)

STAT5B Antibodies for Human

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.