Recombinant Human T-cell antigen CD7(CD7) ,partial

Code CSB-EP004953HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P09564
Relevance Not yet known.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GP40T-cell leukemia antigen;T-cell surface antigen Leu-9TP41; CD7
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Research Area Immunology
Source E.coli
Gene Names CD7
Expression Region 26-180aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 32.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Not yet known.
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

HGNC: 1695

OMIM: 186820

KEGG: hsa:924

STRING: 9606.ENSP00000312027

UniGene: Hs.36972

Pathway Hematopoietic cell lineage

Related Products

CD7 Antibodies

CD7 Antibodies for Human

CD7 Antibodies for Homo sapiens (Human)

CD7 Proteins

CD7 Proteins for Homo sapiens (Human)

CD7 ELISA Kit

CD7 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.