Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial

Code CSB-YP004891HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P29017
Relevance Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM
Research Area Immunology
Source Yeast
Gene Names CD1C
Protein Names Recommended name: T-cell surface glycoprotein CD1c Alternative name(s): CD_antigen= CD1c
Expression Region 18-302aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 34.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
Subcellular Location Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome
Tissue Specificity Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Database Links

HGNC: 1636

OMIM: 188340

KEGG: hsa:911

STRING: 9606.ENSP00000357152

UniGene: Hs.132448

Pathway Hematopoietic cell lineage

Related Products

CD1C Antibodies

CD1C Antibodies for Homo sapiens (Human)

CD1C Antibodies for Human

CD1C Proteins

CD1C Proteins for Homo sapiens (Human)

CD1C ELISA Kit

CD1C ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.