Recombinant Human Transgelin(TAGLN)

Code CSB-RP008044h
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q01995
Relevance Actin cross-linking/gelling protein . Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 22 kDa actin-binding protein;Protein WS3-10Smooth muscle protein 22-alpha ;SM22-alpha
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Research Area Signal Transduction
Source E.coli
Gene Names TAGLN
Expression Region 2-201aa
Tag Info N-terminal GST-tagged
Mol. Weight 49.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Subcellular Location Cytoplasm
Protein Families Calponin family
Database Links

HGNC: 11553

OMIM: 600818

KEGG: hsa:6876

STRING: 9606.ENSP00000278968

UniGene: Hs.410977

Related Products

TAGLN Antibodies

TAGLN Antibodies for Homo sapiens (Human)

TAGLN Antibodies for Human

TAGLN ELISA Kit

TAGLN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.