Code | CSB-YP023887HU1 |
MSDS | |
Size | Pls inquire |
Source | Yeast |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP023887HU1 |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP023887HU1-B |
MSDS | |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-BP023887HU1 |
MSDS | |
Size | Pls inquire |
Source | Baculovirus |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-MP023887HU1 |
MSDS | |
Size | Pls inquire |
Source | Mammalian cell |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I am actually looking at two of your TMEM85 proteins: CSB-BP023887HU1 and CSB-EP023887HU1.
What are the expected molecular weights of these proteins? I will be using them as protein control for my Western blotting experiments.
TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMN
TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL