Recombinant Human Tubulin beta-4A chain(TUBB4A)

Code CSB-YP025324HU
Product Type Recombinant Protein
Size US$2959
Uniprot No. P04350
Relevance Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Tubulin 5 beta Tubulin beta-4 chain
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
Research Area Signal Transduction
Source Yeast
Gene Names TUBB4A
Protein Names Recommended name: Tubulin beta-4A chain Alternative name(s): Tubulin 5 beta Tubulin beta-4 chain
Expression Region 1-444aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 51.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Involvement in disease Dystonia 4, torsion, autosomal dominant (DYT4); Leukodystrophy, hypomyelinating, 6 (HLD)
Subcellular Location Cytoplasm, cytoskeleton
Protein Families Tubulin family
Tissue Specificity Major isotype in brain, where it represents 46% of all beta-tubulins. In the brain, highest expression levels in the cerebellum, followed by putamen and white matter. Moderate levels in testis. Very low levels, if any, in other tissues.
Database Links

HGNC: 20774

OMIM: 128101

KEGG: hsa:10382

STRING: 9606.ENSP00000264071

UniGene: Hs.110837

Pathway Gap junction

Related Products

TUBB4A Antibodies

TUBB4A Antibodies for Human

TUBB4A Proteins

TUBB4A Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.