Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
FLJ12505; OTTHUMP00000035013; OTTHUMP00000035017; OTTHUMP00000228345; OTTHUMP00000228346; OTTHUMP00000228347; RP11-275G3.1; VASH2; VASH2_HUMAN; Vasohibin-2; Vasohibin-like protein
Species
Homo sapiens (Human)
Expression Region
1-355aa
Target Protein Sequence
MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human VASH2 contains amino acids 1-355. This VASH2 protein is expected to have a theoretical molecular weight of 56.4 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal 6xHis-SUMO tag into the VASH2 encoding gene fragment was conducted, allowing for easier detection and purification of the VASH2 protein in subsequent stages.
Human vasohibin-2 (VASH2) serves as a critical regulator in angiogenesis, influencing blood vessel formation. Its main function involves inhibiting endothelial cell proliferation and migration, exerting anti-angiogenic effects. In cardiovascular research, VASH2 contributes to understanding vascular homeostasis and potential therapeutic interventions for angiogenesis-related diseases. Additionally, VASH2 is implicated in cancer biology, where its role in angiogenesis may impact tumor growth and metastasis. Investigating VASH2 provides insights into vascular development, angiogenic disorders, and cancer progression, offering potential applications in cardiovascular medicine and oncology.
